Gene Gene information from NCBI Gene database.
Entrez ID 256130
Gene name Transmembrane protein 196
Gene symbol TMEM196
Synonyms (NCBI Gene)
-
Chromosome 7
Chromosome location 7p21.1
miRNA miRNA information provided by mirtarbase database.
144
miRTarBase ID miRNA Experiments Reference
MIRT716806 hsa-miR-520f-5p HITS-CLIP 19536157
MIRT716805 hsa-miR-7110-3p HITS-CLIP 19536157
MIRT716804 hsa-miR-6817-3p HITS-CLIP 19536157
MIRT716803 hsa-miR-630 HITS-CLIP 19536157
MIRT716802 hsa-miR-6873-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IDA 36355209
GO:0005737 Component Cytoplasm IEA
GO:0008285 Process Negative regulation of cell population proliferation IMP 26056045
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5HYL7
Protein name Transmembrane protein 196
Protein function Acts as a tumor suppressor in lung cancer (PubMed:26056045, PubMed:36355209). Inhibits tumor cell growth by inhibiting cell proliferation and migration and promoting cell apoptosis (PubMed:26056045, PubMed:36355209). Inhibits metastasis of lung
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expression is significantly decreased in lung cancer cells compared to normal lung tissue (at protein level). {ECO:0000269|PubMed:36355209}.
Sequence
MCTSGQIIGSLLVLSVLEIGLGVSSVAVGAVSFSLALREHKPQLGDSSPVWSGVCFLLCG
ICGILCAKKKSGLVMILFSACCICGLIGGILNFQFLRAVTKKTSSLYPLHLASMSLACIG
IGGCTLSSWLTCRLASYEQRRMFSEREHSLHHSHEMAEKEITDNMSNGGPQLIFNGRV
Sequence length 178
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
DEMENTIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
PSORIASIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Asthma Asthma BEFREE 30694883
★☆☆☆☆
Found in Text Mining only
Ataxia Telangiectasia Ataxia Telangiectasia BEFREE 30694883
★☆☆☆☆
Found in Text Mining only
Carcinoma of lung Lung carcinoma BEFREE 26056045, 30536447
★☆☆☆☆
Found in Text Mining only
Lung Neoplasms Lung Neoplasms BEFREE 26056045
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of lung Lung Cancer BEFREE 26056045, 30536447
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 30536447
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 26056045, 30536447
★☆☆☆☆
Found in Text Mining only
Respiration Disorders Respiration Disorders BEFREE 30694883
★☆☆☆☆
Found in Text Mining only
Respiratory Tract Diseases Respiratory Tract Diseases BEFREE 30694883
★☆☆☆☆
Found in Text Mining only