Gene Gene information from NCBI Gene database.
Entrez ID 256126
Gene name Synaptonemal complex central element protein 2
Gene symbol SYCE2
Synonyms (NCBI Gene)
CESC1
Chromosome 19
Chromosome location 19p13.13
Summary The protein encoded by this gene is part of the synaptonemal complex formed between homologous chromosomes during meiotic prophase. The encoded protein associates with SYCP1 and SYCE1 and is found only where chromosome cores are synapsed. [provided by Ref
miRNA miRNA information provided by mirtarbase database.
29
miRTarBase ID miRNA Experiments Reference
MIRT1405089 hsa-miR-221 CLIP-seq
MIRT1405090 hsa-miR-222 CLIP-seq
MIRT1405091 hsa-miR-3122 CLIP-seq
MIRT1405092 hsa-miR-3652 CLIP-seq
MIRT1405093 hsa-miR-3689a-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
GO ID Ontology Definition Evidence Reference
GO:0000801 Component Central element IBA
GO:0000801 Component Central element IEA
GO:0000801 Component Central element ISS
GO:0005515 Function Protein binding IPI 32296183, 33961781
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611487 27411 ENSG00000161860
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6PIF2
Protein name Synaptonemal complex central element protein 2 (Central element synaptonemal complex protein 1)
Protein function Major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Requires SYCP1 in order to be incorporated into the central element. May have a role in the synapto
PDB 6R17 , 6YQF
Family and domains
Sequence
MERQGVDVPHVKCKDQEPQPLGESKEHPRWEENCEEEAGGGPASASCQLTVLEGKSGLYF
SSLDSSIDILQKRAQELIENINKSRQKDHALMTNFRNSLKTKVSDLTEKLEERIYQIYND
HNKIIQEKLQEFTQKMAKISHLETELKQVCHSVETVYKDLCLQPEQSLRLRWGPDHSRGK
SPPRPGNSQPPDVFVSSVAETTSQATASEVQTNRDGEC
Sequence length 218
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
INSOMNIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Colonic Neoplasms Colonic neoplasm Pubtator 38238555 Associate
★☆☆☆☆
Found in Text Mining only