Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	255877
Gene name	BCL6B transcription repressor
Gene symbol	BCL6B
Synonyms (NCBI Gene)	BAZFZBTB28ZNF62
Chromosome	17
Chromosome location	17p13.1

Show/Hide all (55)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022731	hsa-miR-124-3p	Microarray	18668037
MIRT023822	hsa-miR-1-3p	Microarray	18668037
MIRT819431	hsa-miR-1200	CLIP-seq
MIRT819432	hsa-miR-1912	CLIP-seq
MIRT819433	hsa-miR-2052	CLIP-seq
MIRT819434	hsa-miR-2110	CLIP-seq
MIRT819435	hsa-miR-3120-3p	CLIP-seq
MIRT819436	hsa-miR-3151	CLIP-seq
MIRT819437	hsa-miR-3153	CLIP-seq
MIRT819438	hsa-miR-3190	CLIP-seq
MIRT819439	hsa-miR-4265	CLIP-seq
MIRT819440	hsa-miR-4271	CLIP-seq
MIRT819441	hsa-miR-4296	CLIP-seq
MIRT819442	hsa-miR-4322	CLIP-seq
MIRT819443	hsa-miR-4447	CLIP-seq
MIRT819444	hsa-miR-4472	CLIP-seq
MIRT819445	hsa-miR-4481	CLIP-seq
MIRT819446	hsa-miR-4668-5p	CLIP-seq
MIRT819447	hsa-miR-4690-3p	CLIP-seq
MIRT819448	hsa-miR-4725-3p	CLIP-seq
MIRT819449	hsa-miR-4745-5p	CLIP-seq
MIRT819450	hsa-miR-4752	CLIP-seq
MIRT819451	hsa-miR-491-5p	CLIP-seq
MIRT819452	hsa-miR-512-5p	CLIP-seq
MIRT819453	hsa-miR-545	CLIP-seq
MIRT819454	hsa-miR-7	CLIP-seq
MIRT1942148	hsa-miR-3607-3p	CLIP-seq
MIRT1942149	hsa-miR-365	CLIP-seq
MIRT1942150	hsa-miR-3686	CLIP-seq
MIRT1942151	hsa-miR-3921	CLIP-seq
MIRT1942152	hsa-miR-3974	CLIP-seq
MIRT1942153	hsa-miR-4653-5p	CLIP-seq
MIRT2181001	hsa-miR-3161	CLIP-seq
MIRT2181002	hsa-miR-3919	CLIP-seq
MIRT1942151	hsa-miR-3921	CLIP-seq
MIRT2181003	hsa-miR-3942-3p	CLIP-seq
MIRT1942152	hsa-miR-3974	CLIP-seq
MIRT1942153	hsa-miR-4653-5p	CLIP-seq
MIRT2181004	hsa-miR-4756-3p	CLIP-seq
MIRT2181005	hsa-miR-495	CLIP-seq
MIRT2441985	hsa-miR-1273d	CLIP-seq
MIRT2441986	hsa-miR-181a	CLIP-seq
MIRT2441987	hsa-miR-181b	CLIP-seq
MIRT2441988	hsa-miR-181c	CLIP-seq
MIRT2441989	hsa-miR-181d	CLIP-seq
MIRT2441990	hsa-miR-3143	CLIP-seq
MIRT2441991	hsa-miR-4262	CLIP-seq
MIRT2441992	hsa-miR-4726-3p	CLIP-seq
MIRT2441993	hsa-miR-543	CLIP-seq
MIRT2484380	hsa-miR-1324	CLIP-seq
MIRT2484381	hsa-miR-3180-5p	CLIP-seq
MIRT2484382	hsa-miR-4420	CLIP-seq
MIRT2484383	hsa-miR-520a-5p	CLIP-seq
MIRT2484384	hsa-miR-525-5p	CLIP-seq
MIRT2484385	hsa-miR-586	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001817	Process	Regulation of cytokine production	IBA
GO:0002682	Process	Regulation of immune system process	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0042092	Process	Type 2 immune response	IBA
GO:0042127	Process	Regulation of cell population proliferation	IBA
GO:0045595	Process	Regulation of cell differentiation	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0050727	Process	Regulation of inflammatory response	IBA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
608992	1002	ENSG00000161940

Q8N143

Protein name

B-cell CLL/lymphoma 6 member B protein (Bcl6-associated zinc finger protein) (Zinc finger protein 62)

Protein function

Acts as a sequence-specific transcriptional repressor in association with BCL6. May function in a narrow stage or be related to some events in the early B-cell development.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00651	BTB	28 → 135	BTB/POZ domain	Domain
PF00096	zf-C2H2	356 → 378	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	412 → 434	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed with higher expression found in heart and placenta. {ECO:0000269|PubMed:11855826}.

Sequence

MGSPAAPEGALGYVREFTRHSSDVLGNLNELRLRGILTDVTLLVGGQPLRAHKAVLIACS
GFFYSIFRGRAGVGVDVLSLPGGPEARGFAPLLDFMYTSRLRLSPATAPAVLAAATYLQM
EHVVQACHRFIQASYEPLGISLRPLEAEPPTPPTAPPPGSPRRSEGHPDPPTESRSCSQG
PPSPASPDPKACNWKKYKYIVLNSQASQAGSLVGERSSGQPCPQARLPSGDEASSSSSSS
SSSSEEGPIPGPQSRLSPTAATVQFKCGAPASTPYLLTSQAQDTSGSPSERARPLPGSEF
FSCQNCEAVAGCSSGLDSLVPGDEDKPYKCQLCRSSFRYKGNLASHRTVHTGEKPYHCSI
CGARFNRPANLKTHSRIHSGEKPYKCETCGSRFVQVAHLRAHVLIHTGEKPYPCPTCGTR
FRHLQTLKSHVRIHTGEKPYHCDPCGLHFRHKSQLRLHLRQKHGAATNTKVHYHILGGP

Sequence length

479

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (15)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	26957268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25909168, 31754389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25909168, 34269294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29393377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29393377	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Digestive System Neoplasms	Digestive system neoplasm	Pubtator	31754389	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25218345, 25909168, 25970780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	25970780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30286088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29393377	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21917650, 24191714, 25008234, 31288844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21917650, 25008234, 25218345, 29393377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21917650, 24191714, 25218345, 25909168, 29393377, 31754389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21917650, 24191714, 25008234, 31288844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25008234, 25909168	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

BCL6B (BCL6B transcription repressor)