Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	255743
Gene name	Nephronectin
Gene symbol	NPNT
Synonyms (NCBI Gene)	EGFL6LPOEM
Chromosome	4
Chromosome location	4q24

316

Show/Hide all (316)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005422	hsa-miR-378a-3p	GFP reporter assayLuciferase reporter assayWestern blot	19844573
MIRT005422	hsa-miR-378a-3p	GFP reporter assayLuciferase reporter assayWestern blot	19844573
MIRT005422	hsa-miR-378a-3p	GFP reporter assayLuciferase reporter assayWestern blot	19844573
MIRT026404	hsa-miR-192-5p	Microarray	19074876
MIRT039335	hsa-miR-425-5p	CLASH	23622248
MIRT572622	hsa-miR-3923	PAR-CLIP	20371350
MIRT572621	hsa-miR-4661-3p	PAR-CLIP	20371350
MIRT572620	hsa-miR-1323	PAR-CLIP	20371350
MIRT572619	hsa-miR-548o-3p	PAR-CLIP	20371350
MIRT572618	hsa-miR-325	PAR-CLIP	20371350
MIRT572617	hsa-miR-5689	PAR-CLIP	20371350
MIRT308818	hsa-miR-3609	PAR-CLIP	22100165
MIRT308819	hsa-miR-548ah-5p	PAR-CLIP	22100165
MIRT448648	hsa-miR-106a-5p	PAR-CLIP	22100165
MIRT448647	hsa-miR-106b-5p	PAR-CLIP	22100165
MIRT448646	hsa-miR-17-5p	PAR-CLIP	22100165
MIRT448645	hsa-miR-20a-5p	PAR-CLIP	22100165
MIRT448644	hsa-miR-20b-5p	PAR-CLIP	22100165
MIRT448643	hsa-miR-519d-3p	PAR-CLIP	22100165
MIRT448642	hsa-miR-526b-3p	PAR-CLIP	22100165
MIRT448641	hsa-miR-93-5p	PAR-CLIP	22100165
MIRT448640	hsa-miR-4796-3p	PAR-CLIP	22100165
MIRT448639	hsa-miR-494-3p	PAR-CLIP	22100165
MIRT448638	hsa-miR-510-3p	PAR-CLIP	22100165
MIRT572622	hsa-miR-3923	PAR-CLIP	20371350
MIRT572621	hsa-miR-4661-3p	PAR-CLIP	20371350
MIRT572620	hsa-miR-1323	PAR-CLIP	20371350
MIRT572619	hsa-miR-548o-3p	PAR-CLIP	20371350
MIRT572618	hsa-miR-325	PAR-CLIP	20371350
MIRT572617	hsa-miR-5689	PAR-CLIP	20371350
MIRT308818	hsa-miR-3609	PAR-CLIP	22100165
MIRT308819	hsa-miR-548ah-5p	PAR-CLIP	22100165
MIRT448648	hsa-miR-106a-5p	PAR-CLIP	22100165
MIRT448647	hsa-miR-106b-5p	PAR-CLIP	22100165
MIRT448646	hsa-miR-17-5p	PAR-CLIP	22100165
MIRT448645	hsa-miR-20a-5p	PAR-CLIP	22100165
MIRT448644	hsa-miR-20b-5p	PAR-CLIP	22100165
MIRT448643	hsa-miR-519d-3p	PAR-CLIP	22100165
MIRT448642	hsa-miR-526b-3p	PAR-CLIP	22100165
MIRT448641	hsa-miR-93-5p	PAR-CLIP	22100165
MIRT448640	hsa-miR-4796-3p	PAR-CLIP	22100165
MIRT448639	hsa-miR-494-3p	PAR-CLIP	22100165
MIRT448638	hsa-miR-510-3p	PAR-CLIP	22100165
MIRT1191071	hsa-miR-101	CLIP-seq
MIRT1191072	hsa-miR-106a	CLIP-seq
MIRT1191073	hsa-miR-106b	CLIP-seq
MIRT1191074	hsa-miR-1207-5p	CLIP-seq
MIRT1191075	hsa-miR-1243	CLIP-seq
MIRT1191076	hsa-miR-1255a	CLIP-seq
MIRT1191077	hsa-miR-1255b	CLIP-seq
MIRT1191078	hsa-miR-1257	CLIP-seq
MIRT1191079	hsa-miR-1261	CLIP-seq
MIRT1191080	hsa-miR-1273g	CLIP-seq
MIRT1191081	hsa-miR-129-5p	CLIP-seq
MIRT1191082	hsa-miR-130a	CLIP-seq
MIRT1191083	hsa-miR-130b	CLIP-seq
MIRT1191084	hsa-miR-132	CLIP-seq
MIRT1191085	hsa-miR-142-5p	CLIP-seq
MIRT1191086	hsa-miR-144	CLIP-seq
MIRT1191087	hsa-miR-17	CLIP-seq
MIRT1191088	hsa-miR-185	CLIP-seq
MIRT1191089	hsa-miR-190	CLIP-seq
MIRT1191090	hsa-miR-190b	CLIP-seq
MIRT1191091	hsa-miR-1972	CLIP-seq
MIRT1191092	hsa-miR-200b	CLIP-seq
MIRT1191093	hsa-miR-200c	CLIP-seq
MIRT1191094	hsa-miR-20a	CLIP-seq
MIRT1191095	hsa-miR-20b	CLIP-seq
MIRT1191096	hsa-miR-212	CLIP-seq
MIRT1191097	hsa-miR-22	CLIP-seq
MIRT1191098	hsa-miR-301a	CLIP-seq
MIRT1191099	hsa-miR-301b	CLIP-seq
MIRT1191100	hsa-miR-3123	CLIP-seq
MIRT1191101	hsa-miR-3145-3p	CLIP-seq
MIRT1191102	hsa-miR-3151	CLIP-seq
MIRT1191103	hsa-miR-3159	CLIP-seq
MIRT1191104	hsa-miR-3200-3p	CLIP-seq
MIRT1191105	hsa-miR-320a	CLIP-seq
MIRT1191106	hsa-miR-320b	CLIP-seq
MIRT1191107	hsa-miR-320c	CLIP-seq
MIRT1191108	hsa-miR-320d	CLIP-seq
MIRT1191109	hsa-miR-329	CLIP-seq
MIRT1191110	hsa-miR-340	CLIP-seq
MIRT1191111	hsa-miR-346	CLIP-seq
MIRT1191112	hsa-miR-34a	CLIP-seq
MIRT1191113	hsa-miR-34c-5p	CLIP-seq
MIRT1191114	hsa-miR-3591-5p	CLIP-seq
MIRT1191115	hsa-miR-3613-3p	CLIP-seq
MIRT1191116	hsa-miR-362-3p	CLIP-seq
MIRT1191117	hsa-miR-3646	CLIP-seq
MIRT1191118	hsa-miR-3647-3p	CLIP-seq
MIRT1191119	hsa-miR-3666	CLIP-seq
MIRT1191120	hsa-miR-3670	CLIP-seq
MIRT1191121	hsa-miR-374c	CLIP-seq
MIRT1191122	hsa-miR-377	CLIP-seq
MIRT1191123	hsa-miR-3941	CLIP-seq
MIRT1191124	hsa-miR-4276	CLIP-seq
MIRT1191125	hsa-miR-429	CLIP-seq
MIRT1191126	hsa-miR-4295	CLIP-seq
MIRT1191127	hsa-miR-4306	CLIP-seq
MIRT1191128	hsa-miR-4310	CLIP-seq
MIRT1191129	hsa-miR-4328	CLIP-seq
MIRT1191130	hsa-miR-4429	CLIP-seq
MIRT1191131	hsa-miR-4447	CLIP-seq
MIRT1191132	hsa-miR-4457	CLIP-seq
MIRT1191133	hsa-miR-4472	CLIP-seq
MIRT1191134	hsa-miR-4473	CLIP-seq
MIRT1191135	hsa-miR-4475	CLIP-seq
MIRT1191136	hsa-miR-449a	CLIP-seq
MIRT1191137	hsa-miR-449b	CLIP-seq
MIRT1191138	hsa-miR-4527	CLIP-seq
MIRT1191139	hsa-miR-454	CLIP-seq
MIRT1191140	hsa-miR-4637	CLIP-seq
MIRT1191141	hsa-miR-4642	CLIP-seq
MIRT1191142	hsa-miR-4644	CLIP-seq
MIRT1191143	hsa-miR-4650-5p	CLIP-seq
MIRT1191144	hsa-miR-4659a-5p	CLIP-seq
MIRT1191145	hsa-miR-4659b-5p	CLIP-seq
MIRT1191146	hsa-miR-466	CLIP-seq
MIRT1191147	hsa-miR-4671-3p	CLIP-seq
MIRT1191148	hsa-miR-4672	CLIP-seq
MIRT1191149	hsa-miR-4699-3p	CLIP-seq
MIRT1191150	hsa-miR-4709-3p	CLIP-seq
MIRT1191151	hsa-miR-4724-3p	CLIP-seq
MIRT1191152	hsa-miR-4763-3p	CLIP-seq
MIRT1191153	hsa-miR-4766-5p	CLIP-seq
MIRT1191154	hsa-miR-4776-3p	CLIP-seq
MIRT1191155	hsa-miR-4778-3p	CLIP-seq
MIRT1191156	hsa-miR-4789-3p	CLIP-seq
MIRT1191157	hsa-miR-4789-5p	CLIP-seq
MIRT1191158	hsa-miR-4790-3p	CLIP-seq
MIRT1191159	hsa-miR-486-3p	CLIP-seq
MIRT1191160	hsa-miR-488	CLIP-seq
MIRT1191161	hsa-miR-490-5p	CLIP-seq
MIRT1191162	hsa-miR-491-5p	CLIP-seq
MIRT1191163	hsa-miR-494	CLIP-seq
MIRT1191164	hsa-miR-499-3p	CLIP-seq
MIRT1191165	hsa-miR-499a-3p	CLIP-seq
MIRT1191166	hsa-miR-501-3p	CLIP-seq
MIRT1191167	hsa-miR-502-3p	CLIP-seq
MIRT1191168	hsa-miR-513b	CLIP-seq
MIRT1191169	hsa-miR-513c	CLIP-seq
MIRT1191170	hsa-miR-514b-5p	CLIP-seq
MIRT1191171	hsa-miR-519d	CLIP-seq
MIRT1191172	hsa-miR-520d-5p	CLIP-seq
MIRT1191173	hsa-miR-524-5p	CLIP-seq
MIRT1191174	hsa-miR-548ah	CLIP-seq
MIRT1191175	hsa-miR-548n	CLIP-seq
MIRT1191176	hsa-miR-548t	CLIP-seq
MIRT1191177	hsa-miR-603	CLIP-seq
MIRT1191178	hsa-miR-655	CLIP-seq
MIRT1191179	hsa-miR-759	CLIP-seq
MIRT1191180	hsa-miR-891b	CLIP-seq
MIRT1191181	hsa-miR-93	CLIP-seq
MIRT1191182	hsa-miR-938	CLIP-seq
MIRT1191183	hsa-miR-214	CLIP-seq
MIRT1191184	hsa-miR-221	CLIP-seq
MIRT1191185	hsa-miR-222	CLIP-seq
MIRT1191100	hsa-miR-3123	CLIP-seq
MIRT1191186	hsa-miR-3619-5p	CLIP-seq
MIRT1191118	hsa-miR-3647-3p	CLIP-seq
MIRT1191187	hsa-miR-3680	CLIP-seq
MIRT1191122	hsa-miR-377	CLIP-seq
MIRT1191123	hsa-miR-3941	CLIP-seq
MIRT1191188	hsa-miR-4291	CLIP-seq
MIRT1191189	hsa-miR-4495	CLIP-seq
MIRT1191190	hsa-miR-4639-3p	CLIP-seq
MIRT1191146	hsa-miR-466	CLIP-seq
MIRT1191148	hsa-miR-4672	CLIP-seq
MIRT1191191	hsa-miR-4731-3p	CLIP-seq
MIRT1191192	hsa-miR-4801	CLIP-seq
MIRT1191166	hsa-miR-501-3p	CLIP-seq
MIRT1191167	hsa-miR-502-3p	CLIP-seq
MIRT1191193	hsa-miR-548a-3p	CLIP-seq
MIRT1191194	hsa-miR-548ac	CLIP-seq
MIRT1191195	hsa-miR-548ae	CLIP-seq
MIRT1191196	hsa-miR-548aj	CLIP-seq
MIRT1191197	hsa-miR-548am	CLIP-seq
MIRT1191198	hsa-miR-548d-3p	CLIP-seq
MIRT1191199	hsa-miR-548e	CLIP-seq
MIRT1191200	hsa-miR-548f	CLIP-seq
MIRT1191201	hsa-miR-548v	CLIP-seq
MIRT1191202	hsa-miR-548x	CLIP-seq
MIRT1191203	hsa-miR-548z	CLIP-seq
MIRT1191204	hsa-miR-761	CLIP-seq
MIRT1191205	hsa-miR-889	CLIP-seq
MIRT1191206	hsa-miR-922	CLIP-seq
MIRT1191072	hsa-miR-106a	CLIP-seq
MIRT1191073	hsa-miR-106b	CLIP-seq
MIRT1191074	hsa-miR-1207-5p	CLIP-seq
MIRT1191207	hsa-miR-1225-5p	CLIP-seq
MIRT1191208	hsa-miR-1252	CLIP-seq
MIRT1191078	hsa-miR-1257	CLIP-seq
MIRT1191081	hsa-miR-129-5p	CLIP-seq
MIRT1191082	hsa-miR-130a	CLIP-seq
MIRT1191083	hsa-miR-130b	CLIP-seq
MIRT1191085	hsa-miR-142-5p	CLIP-seq
MIRT1191087	hsa-miR-17	CLIP-seq
MIRT1191089	hsa-miR-190	CLIP-seq
MIRT1191090	hsa-miR-190b	CLIP-seq
MIRT1191092	hsa-miR-200b	CLIP-seq
MIRT1191093	hsa-miR-200c	CLIP-seq
MIRT1191094	hsa-miR-20a	CLIP-seq
MIRT1191095	hsa-miR-20b	CLIP-seq
MIRT1191097	hsa-miR-22	CLIP-seq
MIRT1191098	hsa-miR-301a	CLIP-seq
MIRT1191099	hsa-miR-301b	CLIP-seq
MIRT1191209	hsa-miR-3121-3p	CLIP-seq
MIRT1191102	hsa-miR-3151	CLIP-seq
MIRT1191103	hsa-miR-3159	CLIP-seq
MIRT1191210	hsa-miR-3189-3p	CLIP-seq
MIRT1191109	hsa-miR-329	CLIP-seq
MIRT1191110	hsa-miR-340	CLIP-seq
MIRT1191111	hsa-miR-346	CLIP-seq
MIRT1191112	hsa-miR-34a	CLIP-seq
MIRT1191113	hsa-miR-34c-5p	CLIP-seq
MIRT1191114	hsa-miR-3591-5p	CLIP-seq
MIRT1191116	hsa-miR-362-3p	CLIP-seq
MIRT1191119	hsa-miR-3666	CLIP-seq
MIRT1191121	hsa-miR-374c	CLIP-seq
MIRT1191123	hsa-miR-3941	CLIP-seq
MIRT1191125	hsa-miR-429	CLIP-seq
MIRT1191126	hsa-miR-4295	CLIP-seq
MIRT1191129	hsa-miR-4328	CLIP-seq
MIRT1191131	hsa-miR-4447	CLIP-seq
MIRT1191132	hsa-miR-4457	CLIP-seq
MIRT1191133	hsa-miR-4472	CLIP-seq
MIRT1191134	hsa-miR-4473	CLIP-seq
MIRT1191136	hsa-miR-449a	CLIP-seq
MIRT1191137	hsa-miR-449b	CLIP-seq
MIRT1191211	hsa-miR-4502	CLIP-seq
MIRT1191138	hsa-miR-4527	CLIP-seq
MIRT1191139	hsa-miR-454	CLIP-seq
MIRT1191141	hsa-miR-4642	CLIP-seq
MIRT1191144	hsa-miR-4659a-5p	CLIP-seq
MIRT1191145	hsa-miR-4659b-5p	CLIP-seq
MIRT1191146	hsa-miR-466	CLIP-seq
MIRT1191147	hsa-miR-4671-3p	CLIP-seq
MIRT1191148	hsa-miR-4672	CLIP-seq
MIRT1191212	hsa-miR-4738-3p	CLIP-seq
MIRT1191152	hsa-miR-4763-3p	CLIP-seq
MIRT1191154	hsa-miR-4776-3p	CLIP-seq
MIRT1191158	hsa-miR-4790-3p	CLIP-seq
MIRT1191159	hsa-miR-486-3p	CLIP-seq
MIRT1191213	hsa-miR-487a	CLIP-seq
MIRT1191162	hsa-miR-491-5p	CLIP-seq
MIRT1191214	hsa-miR-502-5p	CLIP-seq
MIRT1191168	hsa-miR-513b	CLIP-seq
MIRT1191171	hsa-miR-519d	CLIP-seq
MIRT1191174	hsa-miR-548ah	CLIP-seq
MIRT1191177	hsa-miR-603	CLIP-seq
MIRT1191178	hsa-miR-655	CLIP-seq
MIRT1191181	hsa-miR-93	CLIP-seq
MIRT1191182	hsa-miR-938	CLIP-seq
MIRT1922888	hsa-miR-766	CLIP-seq
MIRT1191082	hsa-miR-130a	CLIP-seq
MIRT1191083	hsa-miR-130b	CLIP-seq
MIRT1191098	hsa-miR-301a	CLIP-seq
MIRT1191099	hsa-miR-301b	CLIP-seq
MIRT1191119	hsa-miR-3666	CLIP-seq
MIRT1191126	hsa-miR-4295	CLIP-seq
MIRT1191139	hsa-miR-454	CLIP-seq
MIRT1191147	hsa-miR-4671-3p	CLIP-seq
MIRT1191082	hsa-miR-130a	CLIP-seq
MIRT1191083	hsa-miR-130b	CLIP-seq
MIRT2055378	hsa-miR-2392	CLIP-seq
MIRT1191098	hsa-miR-301a	CLIP-seq
MIRT1191099	hsa-miR-301b	CLIP-seq
MIRT1191110	hsa-miR-340	CLIP-seq
MIRT1191119	hsa-miR-3666	CLIP-seq
MIRT2055379	hsa-miR-4268	CLIP-seq
MIRT1191126	hsa-miR-4295	CLIP-seq
MIRT2055380	hsa-miR-4448	CLIP-seq
MIRT1191132	hsa-miR-4457	CLIP-seq
MIRT1191189	hsa-miR-4495	CLIP-seq
MIRT1191139	hsa-miR-454	CLIP-seq
MIRT1191147	hsa-miR-4671-3p	CLIP-seq
MIRT2055381	hsa-miR-4742-3p	CLIP-seq
MIRT2284255	hsa-miR-1206	CLIP-seq
MIRT1191082	hsa-miR-130a	CLIP-seq
MIRT1191083	hsa-miR-130b	CLIP-seq
MIRT1191098	hsa-miR-301a	CLIP-seq
MIRT1191099	hsa-miR-301b	CLIP-seq
MIRT1191112	hsa-miR-34a	CLIP-seq
MIRT1191113	hsa-miR-34c-5p	CLIP-seq
MIRT1191114	hsa-miR-3591-5p	CLIP-seq
MIRT1191119	hsa-miR-3666	CLIP-seq
MIRT1191126	hsa-miR-4295	CLIP-seq
MIRT1191129	hsa-miR-4328	CLIP-seq
MIRT1191134	hsa-miR-4473	CLIP-seq
MIRT1191136	hsa-miR-449a	CLIP-seq
MIRT1191137	hsa-miR-449b	CLIP-seq
MIRT1191139	hsa-miR-454	CLIP-seq
MIRT1191141	hsa-miR-4642	CLIP-seq
MIRT1191147	hsa-miR-4671-3p	CLIP-seq
MIRT1191156	hsa-miR-4789-3p	CLIP-seq
MIRT1191169	hsa-miR-513c	CLIP-seq
MIRT1191170	hsa-miR-514b-5p	CLIP-seq
MIRT1191175	hsa-miR-548n	CLIP-seq
MIRT1191176	hsa-miR-548t	CLIP-seq
MIRT1191179	hsa-miR-759	CLIP-seq
MIRT2455351	hsa-miR-3127-3p	CLIP-seq
MIRT2455352	hsa-miR-3679-3p	CLIP-seq
MIRT2455353	hsa-miR-4282	CLIP-seq
MIRT2455354	hsa-miR-4446-5p	CLIP-seq
MIRT2455355	hsa-miR-4729	CLIP-seq
MIRT2455356	hsa-miR-579	CLIP-seq
MIRT1191208	hsa-miR-1252	CLIP-seq
MIRT2465737	hsa-miR-3545-3p	CLIP-seq
MIRT2465738	hsa-miR-3921	CLIP-seq
MIRT2465739	hsa-miR-4326	CLIP-seq
MIRT2465740	hsa-miR-4539	CLIP-seq
MIRT2465741	hsa-miR-4635	CLIP-seq
MIRT2465742	hsa-miR-4653-5p	CLIP-seq
MIRT1191214	hsa-miR-502-5p	CLIP-seq
MIRT2465743	hsa-miR-892a	CLIP-seq

Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001657	Process	Ureteric bud development	IEA
GO:0001657	Process	Ureteric bud development	ISS	15754038
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	ISS	15754038
GO:0005178	Function	Integrin binding	IEA
GO:0005178	Function	Integrin binding	ISS	15754038
GO:0005178	Function	Integrin binding	NAS	11470831
GO:0005201	Function	Extracellular matrix structural constituent	RCA	25037231, 28675934
GO:0005509	Function	Calcium ion binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	ISS	15754038
GO:0005604	Component	Basement membrane	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	ISS	15754038
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0010811	Process	Positive regulation of cell-substrate adhesion	IEA
GO:0010811	Process	Positive regulation of cell-substrate adhesion	ISS	15754038
GO:0016020	Component	Membrane	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0030198	Process	Extracellular matrix organization	ISS	15754038
GO:0030485	Component	Smooth muscle contractile fiber	IEA
GO:0030511	Process	Positive regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0031012	Component	Extracellular matrix	HDA	25037231, 28675934
GO:0031012	Component	Extracellular matrix	IEA
GO:0031012	Component	Extracellular matrix	ISS
GO:0033631	Process	Cell-cell adhesion mediated by integrin	IEA
GO:0033631	Process	Cell-cell adhesion mediated by integrin	ISS	15754038
GO:0045184	Process	Establishment of protein localization	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	ISS	15754038
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045987	Process	Positive regulation of smooth muscle contraction	IEA
GO:0051145	Process	Smooth muscle cell differentiation	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS	15754038
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	ISS	15754038
GO:0097195	Process	Pilomotor reflex	IEA

MIM	HGNC	e!Ensembl
610306	27405	ENSG00000168743

Q6UXI9

Protein name

Nephronectin (Preosteoblast EGF-like repeat protein with MAM domain) (Protein EGFL6-like)

Protein function

Functional ligand of integrin alpha-8/beta-1 in kidney development. Regulates the expression of GDNF with integrin alpha-8/beta-1 which is essential for kidney development. May also play a role in the development and function of various tissues,

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07645	EGF_CA	89 → 133	Calcium-binding EGF domain	Domain
PF07645	EGF_CA	169 → 212	Calcium-binding EGF domain	Domain
PF07645	EGF_CA	214 → 253	Calcium-binding EGF domain	Domain
PF00629	MAM	422 → 562	MAM domain, meprin/A5/mu	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in kidney and lung and to a lower extent in brain, pregnant uterus, placenta, thyroid gland and blood vessels. {ECO:0000269|PubMed:15754038}.

Sequence

MDFLLALVLVSSLYLQAAAEFDGRWPRQIVSSIGLCRYGGRIDCCWGWARQSWGQCQPVC
QPRCKHGECIGPNKCKCHPGYAGKTCNQDLNECGLKPRPCKHRCMNTYGSYKCYCLNGYM
LMPDGSCSSALTCSMANCQYGCDVVKGQIRCQCPSPGLQLAPDGRTCVDVDECATGRASC
PRFRQCVNTFGSYICKCHKGFDLMYIGGKYQCHDIDECSLGQYQCSSFARCYNIRGSYKC
KCKEGYQGDGLTCVYIPKVMIEPSGPIHVPKGNGTILKGDTGNNNWIPDVGSTWWPPKTP
YIPPIITNRPTSKPTTRPTPKPTPIPTPPPPPPLPTELRTPLPPTTPERPTTGLTTIAPA
ASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFEIERGVSADDEAKDDPGVLVH
SCNFDHGLCGWIREKDNDLHWEPIRDPAGGQYLTVSAAKAPGGKAARLVLPLGRLMHSGD
LCLSFRHKVTGLHSGTLQVFVRKHGAHGAALWGRNGGHGWRQTQITLRGADIKSVVFKGE
KRRGHTGEIGLDDVSLKKGHCSEER

Sequence length

565

Interactions

View interactions

	KEGG
	ECM-receptor interaction

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL ABSENCE OF KIDNEYS SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (39)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis	Arthritis	BEFREE	31705832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrioventricular Septal Defect	Atrioventricular septal defect	BEFREE	28513838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	28975640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31705832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18271919, 28842827, 29539586, 30524949, 30591862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of the kidney and urinary tract	Pubtator	36292572	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	21659657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	30804561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conn Adenoma	Conn Adenoma	BEFREE	28416583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	BEFREE	28660419, 30232618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	30362939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	28905999, 28975640, 30471085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	28905999, 28975640, 30362939, 30471085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Achalasia	Achalasia	BEFREE	28316620, 28660419, 30606216, 30881999, 31848870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	28660419, 31848870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	28476557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	30606216		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastroparesis	Gastroparesis	BEFREE	31062275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	28416583	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28416583, 31038904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases Cystic	Kidney disease	Pubtator	36292572	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	20010835, 26635082	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	26635082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	36870548	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18271919, 28842827, 29539586, 30524949, 30591862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30169645, 30591862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28513838, 30707844		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	18271919, 28513838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	28476557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15671244, 28842827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	29891875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	29891875	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30261983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	27782206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21659657, 26423011, 36128198, 37794074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31130697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	28476557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only

NPNT (nephronectin)