Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	255324
Gene name	Epithelial mitogen
Gene symbol	EPGN
Synonyms (NCBI Gene)	ALGV3072EPGPRO9904
Chromosome	4
Chromosome location	4q13.3
Summary	The protein encoded by this gene is a member of the epidermal growth factor family. Members of this family are ligands for the epidermal growth factor receptor and play a role in cell survival, proliferation and migration. This protein has been reported t

Show/Hide all (83)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022200	hsa-miR-124-3p	Microarray	18668037
MIRT716659	hsa-miR-6834-3p	HITS-CLIP	19536157
MIRT716658	hsa-miR-1266-3p	HITS-CLIP	19536157
MIRT716657	hsa-miR-7159-3p	HITS-CLIP	19536157
MIRT716656	hsa-miR-30a-3p	HITS-CLIP	19536157
MIRT716655	hsa-miR-30d-3p	HITS-CLIP	19536157
MIRT716654	hsa-miR-30e-3p	HITS-CLIP	19536157
MIRT716653	hsa-miR-335-3p	HITS-CLIP	19536157
MIRT716652	hsa-miR-486-5p	HITS-CLIP	19536157
MIRT716651	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT716650	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT716649	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT716648	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT716647	hsa-miR-4695-5p	HITS-CLIP	19536157
MIRT716646	hsa-miR-4768-3p	HITS-CLIP	19536157
MIRT716645	hsa-miR-4459	HITS-CLIP	19536157
MIRT716644	hsa-miR-4433a-3p	HITS-CLIP	19536157
MIRT716643	hsa-miR-3612	HITS-CLIP	19536157
MIRT716642	hsa-miR-650	HITS-CLIP	19536157
MIRT643846	hsa-miR-361-5p	HITS-CLIP	19536157
MIRT643844	hsa-miR-374a-3p	HITS-CLIP	19536157
MIRT643845	hsa-miR-4775	HITS-CLIP	23824327
MIRT643846	hsa-miR-361-5p	HITS-CLIP	23824327
MIRT643844	hsa-miR-374a-3p	HITS-CLIP	23824327
MIRT497173	hsa-miR-5683	PAR-CLIP	22291592
MIRT497172	hsa-miR-3675-3p	PAR-CLIP	22291592
MIRT497171	hsa-miR-532-5p	PAR-CLIP	22291592
MIRT497170	hsa-miR-139-5p	PAR-CLIP	22291592
MIRT497169	hsa-miR-4695-3p	PAR-CLIP	22291592
MIRT497168	hsa-miR-4312	PAR-CLIP	22291592
MIRT497167	hsa-miR-4684-5p	PAR-CLIP	22291592
MIRT497166	hsa-miR-7641	PAR-CLIP	22291592
MIRT716659	hsa-miR-6834-3p	HITS-CLIP	19536157
MIRT716658	hsa-miR-1266-3p	HITS-CLIP	19536157
MIRT716657	hsa-miR-7159-3p	HITS-CLIP	19536157
MIRT716656	hsa-miR-30a-3p	HITS-CLIP	19536157
MIRT716655	hsa-miR-30d-3p	HITS-CLIP	19536157
MIRT716654	hsa-miR-30e-3p	HITS-CLIP	19536157
MIRT716653	hsa-miR-335-3p	HITS-CLIP	19536157
MIRT716652	hsa-miR-486-5p	HITS-CLIP	19536157
MIRT716651	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT716650	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT716649	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT716648	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT716647	hsa-miR-4695-5p	HITS-CLIP	19536157
MIRT716646	hsa-miR-4768-3p	HITS-CLIP	19536157
MIRT716645	hsa-miR-4459	HITS-CLIP	19536157
MIRT716644	hsa-miR-4433a-3p	HITS-CLIP	19536157
MIRT716643	hsa-miR-3612	HITS-CLIP	19536157
MIRT716642	hsa-miR-650	HITS-CLIP	19536157
MIRT643846	hsa-miR-361-5p	HITS-CLIP	19536157
MIRT643844	hsa-miR-374a-3p	HITS-CLIP	19536157
MIRT643845	hsa-miR-4775	HITS-CLIP	23824327
MIRT643846	hsa-miR-361-5p	HITS-CLIP	23824327
MIRT643844	hsa-miR-374a-3p	HITS-CLIP	23824327
MIRT497173	hsa-miR-5683	PAR-CLIP	22291592
MIRT497172	hsa-miR-3675-3p	PAR-CLIP	22291592
MIRT497171	hsa-miR-532-5p	PAR-CLIP	22291592
MIRT497170	hsa-miR-139-5p	PAR-CLIP	22291592
MIRT497169	hsa-miR-4695-3p	PAR-CLIP	22291592
MIRT497168	hsa-miR-4312	PAR-CLIP	22291592
MIRT497167	hsa-miR-4684-5p	PAR-CLIP	22291592
MIRT497166	hsa-miR-7641	PAR-CLIP	22291592
MIRT966213	hsa-miR-148a	CLIP-seq
MIRT966214	hsa-miR-148b	CLIP-seq
MIRT966215	hsa-miR-152	CLIP-seq
MIRT966216	hsa-miR-223	CLIP-seq
MIRT966217	hsa-miR-3065-5p	CLIP-seq
MIRT966218	hsa-miR-4528	CLIP-seq
MIRT966219	hsa-miR-4666-5p	CLIP-seq
MIRT966220	hsa-miR-4697-3p	CLIP-seq
MIRT966221	hsa-miR-515-3p	CLIP-seq
MIRT966222	hsa-miR-519e	CLIP-seq
MIRT966223	hsa-miR-526b	CLIP-seq
MIRT966224	hsa-miR-550a	CLIP-seq
MIRT966225	hsa-miR-642b	CLIP-seq
MIRT2220828	hsa-miR-1296	CLIP-seq
MIRT2220829	hsa-miR-2861	CLIP-seq
MIRT2220830	hsa-miR-3140-5p	CLIP-seq
MIRT2220831	hsa-miR-4427	CLIP-seq
MIRT2220832	hsa-miR-4512	CLIP-seq
MIRT966218	hsa-miR-4528	CLIP-seq
MIRT966225	hsa-miR-642b	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0001525	Process	Angiogenesis	IDA	15611079
GO:0005154	Function	Epidermal growth factor receptor binding	IBA
GO:0005154	Function	Epidermal growth factor receptor binding	IPI	15611079
GO:0005515	Function	Protein binding	IPI	28988771, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	IDA	15611079
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IBA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IDA	15611079
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IEA
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IDA	15611079
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	15611079
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0016020	Component	Membrane	IEA
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IEA
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	15611079
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	ISS
GO:0045840	Process	Positive regulation of mitotic nuclear division	IBA
GO:0045840	Process	Positive regulation of mitotic nuclear division	IDA	15611079
GO:0048018	Function	Receptor ligand activity	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	ISS

MIM	HGNC	e!Ensembl
618717	17470	ENSG00000182585

Q6UW88

Protein name

Epigen (Epithelial mitogen) (EPG)

Protein function

Promotes the growth of epithelial cells. May stimulate the phosphorylation of EGFR and mitogen-activated protein kinases.

PDB

5WB8

Family and domains

Sequence

MALGVPISVYLLFNAMTALTEEAAVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLC
LEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYAVDSYEKYIAIGIGVGL
LLSGFLVIFYCYIRKRCLKLKSPYNVCSGERRPL

Sequence length

154

Interactions

View interactions

	Reactome
			PIP3 activates AKT signaling Signaling by EGFR GRB2 events in EGFR signaling GAB1 signalosome SHC1 events in EGFR signaling EGFR downregulation EGFR interacts with phospholipase C-gamma Constitutive Signaling by Aberrant PI3K in Cancer Inhibition of Signaling by Overexpressed EGFR RAF/MAP kinase cascade PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling Cargo recognition for clathrin-mediated endocytosis Clathrin-mediated endocytosis Extra-nuclear estrogen signaling Estrogen-dependent nuclear events downstream of ESR-membrane signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (13)

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Absent corpus callosum cataract immunodeficiency	Vici syndrome	BEFREE	26927810	★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha-Thalassemia	alpha Thalassemia	BEFREE	6546982	★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha^+^ Thalassemia	alpha Thalassemia	BEFREE	6546982	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	29703138	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27019068	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17169360	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	26927810	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral demyelinating neuropathy	Demyelinating neuropathy	BEFREE	23899604	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	23899604	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	23899604	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seborrheic dermatitis	Seborrheic dermatitis	BEFREE	24503019	★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	25520391	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27019068	★★★★★ ★☆☆☆☆ Found in Text Mining only

EPGN (epithelial mitogen)