Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2551
Gene name	GA binding protein transcription factor subunit alpha
Gene symbol	GABPA
Synonyms (NCBI Gene)	E4TF1-60E4TF1ANFT2NRF2NRF2ARCH04A07
Chromosome	21
Chromosome location	21q21.3
Summary	This gene encodes one of three GA-binding protein transcription factor subunits which functions as a DNA-binding subunit. Since this subunit shares identity with a subunit encoding the nuclear respiratory factor 2 gene, it is likely involved in activation

253

Show/Hide all (253)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031329	hsa-miR-18a-5p	Sequencing	20371350
MIRT048948	hsa-miR-92a-3p	CLASH	23622248
MIRT297783	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT297779	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT297781	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT297778	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT297787	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT297782	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT297780	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT557712	hsa-miR-6835-3p	PAR-CLIP	20371350
MIRT557713	hsa-miR-4422	PAR-CLIP	20371350
MIRT297785	hsa-miR-6758-5p	PAR-CLIP	20371350
MIRT297788	hsa-miR-6856-5p	PAR-CLIP	20371350
MIRT297786	hsa-miR-6783-5p	PAR-CLIP	20371350
MIRT297784	hsa-miR-922	PAR-CLIP	20371350
MIRT557711	hsa-miR-4744	PAR-CLIP	20371350
MIRT557710	hsa-miR-4509	PAR-CLIP	20371350
MIRT557709	hsa-miR-4261	PAR-CLIP	20371350
MIRT297783	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT297779	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT297781	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT297778	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT297787	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT297782	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT297780	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT557712	hsa-miR-6835-3p	PAR-CLIP	21572407
MIRT557713	hsa-miR-4422	PAR-CLIP	21572407
MIRT297785	hsa-miR-6758-5p	PAR-CLIP	21572407
MIRT297788	hsa-miR-6856-5p	PAR-CLIP	21572407
MIRT297786	hsa-miR-6783-5p	PAR-CLIP	21572407
MIRT297784	hsa-miR-922	PAR-CLIP	21572407
MIRT557711	hsa-miR-4744	PAR-CLIP	21572407
MIRT557710	hsa-miR-4509	PAR-CLIP	21572407
MIRT557709	hsa-miR-4261	PAR-CLIP	21572407
MIRT548138	hsa-miR-7844-5p	PAR-CLIP	21572407
MIRT548137	hsa-miR-6731-3p	PAR-CLIP	21572407
MIRT548136	hsa-miR-378a-5p	PAR-CLIP	21572407
MIRT548135	hsa-miR-1200	PAR-CLIP	21572407
MIRT548134	hsa-miR-943	PAR-CLIP	21572407
MIRT548133	hsa-miR-3692-3p	PAR-CLIP	21572407
MIRT737374	hsa-miR-146a-3p	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)qRT-PCR	32303750
MIRT297783	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT297779	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT297781	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT297778	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT297787	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT297782	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT297780	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT557712	hsa-miR-6835-3p	PAR-CLIP	20371350
MIRT557713	hsa-miR-4422	PAR-CLIP	20371350
MIRT297785	hsa-miR-6758-5p	PAR-CLIP	20371350
MIRT297788	hsa-miR-6856-5p	PAR-CLIP	20371350
MIRT297786	hsa-miR-6783-5p	PAR-CLIP	20371350
MIRT297784	hsa-miR-922	PAR-CLIP	20371350
MIRT557711	hsa-miR-4744	PAR-CLIP	20371350
MIRT557710	hsa-miR-4509	PAR-CLIP	20371350
MIRT557709	hsa-miR-4261	PAR-CLIP	20371350
MIRT297783	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT297779	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT297781	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT297778	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT297787	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT297782	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT297780	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT557712	hsa-miR-6835-3p	PAR-CLIP	21572407
MIRT557713	hsa-miR-4422	PAR-CLIP	21572407
MIRT297785	hsa-miR-6758-5p	PAR-CLIP	21572407
MIRT297788	hsa-miR-6856-5p	PAR-CLIP	21572407
MIRT297786	hsa-miR-6783-5p	PAR-CLIP	21572407
MIRT297784	hsa-miR-922	PAR-CLIP	21572407
MIRT557711	hsa-miR-4744	PAR-CLIP	21572407
MIRT557710	hsa-miR-4509	PAR-CLIP	21572407
MIRT557709	hsa-miR-4261	PAR-CLIP	21572407
MIRT548138	hsa-miR-7844-5p	PAR-CLIP	21572407
MIRT548137	hsa-miR-6731-3p	PAR-CLIP	21572407
MIRT548136	hsa-miR-378a-5p	PAR-CLIP	21572407
MIRT548135	hsa-miR-1200	PAR-CLIP	21572407
MIRT548134	hsa-miR-943	PAR-CLIP	21572407
MIRT548133	hsa-miR-3692-3p	PAR-CLIP	21572407
MIRT1009525	hsa-miR-1236	CLIP-seq
MIRT1009526	hsa-miR-2054	CLIP-seq
MIRT1009527	hsa-miR-3159	CLIP-seq
MIRT1009528	hsa-miR-3182	CLIP-seq
MIRT1009529	hsa-miR-3183	CLIP-seq
MIRT1009530	hsa-miR-329	CLIP-seq
MIRT1009531	hsa-miR-3613-3p	CLIP-seq
MIRT1009532	hsa-miR-3617	CLIP-seq
MIRT1009533	hsa-miR-362-3p	CLIP-seq
MIRT1009534	hsa-miR-3671	CLIP-seq
MIRT1009535	hsa-miR-369-3p	CLIP-seq
MIRT1009536	hsa-miR-374a	CLIP-seq
MIRT1009537	hsa-miR-374b	CLIP-seq
MIRT1009538	hsa-miR-380	CLIP-seq
MIRT1009539	hsa-miR-3924	CLIP-seq
MIRT1009540	hsa-miR-3941	CLIP-seq
MIRT1009541	hsa-miR-410	CLIP-seq
MIRT1009542	hsa-miR-4461	CLIP-seq
MIRT1009543	hsa-miR-4469	CLIP-seq
MIRT1009544	hsa-miR-4643	CLIP-seq
MIRT1009545	hsa-miR-4652-3p	CLIP-seq
MIRT1009546	hsa-miR-466	CLIP-seq
MIRT1009547	hsa-miR-4686	CLIP-seq
MIRT1009548	hsa-miR-4712-3p	CLIP-seq
MIRT1009549	hsa-miR-4723-3p	CLIP-seq
MIRT1009550	hsa-miR-4727-5p	CLIP-seq
MIRT1009551	hsa-miR-4753-3p	CLIP-seq
MIRT1009552	hsa-miR-4769-3p	CLIP-seq
MIRT1009553	hsa-miR-4775	CLIP-seq
MIRT1009554	hsa-miR-4789-3p	CLIP-seq
MIRT1009555	hsa-miR-4795-3p	CLIP-seq
MIRT1009556	hsa-miR-502-5p	CLIP-seq
MIRT1009557	hsa-miR-548a-5p	CLIP-seq
MIRT1009558	hsa-miR-548ab	CLIP-seq
MIRT1009559	hsa-miR-548ak	CLIP-seq
MIRT1009560	hsa-miR-548b-5p	CLIP-seq
MIRT1009561	hsa-miR-548c-5p	CLIP-seq
MIRT1009562	hsa-miR-548d-5p	CLIP-seq
MIRT1009563	hsa-miR-548g	CLIP-seq
MIRT1009564	hsa-miR-548h	CLIP-seq
MIRT1009565	hsa-miR-548i	CLIP-seq
MIRT1009566	hsa-miR-548j	CLIP-seq
MIRT1009567	hsa-miR-548n	CLIP-seq
MIRT1009568	hsa-miR-548w	CLIP-seq
MIRT1009569	hsa-miR-548y	CLIP-seq
MIRT1009570	hsa-miR-559	CLIP-seq
MIRT1009571	hsa-miR-590-3p	CLIP-seq
MIRT1009572	hsa-miR-593	CLIP-seq
MIRT1009573	hsa-miR-603	CLIP-seq
MIRT1009574	hsa-miR-607	CLIP-seq
MIRT1009575	hsa-miR-633	CLIP-seq
MIRT1009576	hsa-miR-641	CLIP-seq
MIRT1009577	hsa-miR-642a	CLIP-seq
MIRT1009578	hsa-miR-942	CLIP-seq
MIRT1009579	hsa-miR-1305	CLIP-seq
MIRT1009580	hsa-miR-15a	CLIP-seq
MIRT1009581	hsa-miR-15b	CLIP-seq
MIRT1009582	hsa-miR-16	CLIP-seq
MIRT1009583	hsa-miR-195	CLIP-seq
MIRT1009584	hsa-miR-23a	CLIP-seq
MIRT1009585	hsa-miR-23b	CLIP-seq
MIRT1009586	hsa-miR-23c	CLIP-seq
MIRT1009587	hsa-miR-3148	CLIP-seq
MIRT1009588	hsa-miR-320e	CLIP-seq
MIRT1009531	hsa-miR-3613-3p	CLIP-seq
MIRT1009589	hsa-miR-361-5p	CLIP-seq
MIRT1009590	hsa-miR-365	CLIP-seq
MIRT1009591	hsa-miR-3688-3p	CLIP-seq
MIRT1009538	hsa-miR-380	CLIP-seq
MIRT1009592	hsa-miR-409-3p	CLIP-seq
MIRT1009593	hsa-miR-424	CLIP-seq
MIRT1009594	hsa-miR-4307	CLIP-seq
MIRT1009595	hsa-miR-4312	CLIP-seq
MIRT1009596	hsa-miR-4434	CLIP-seq
MIRT1009597	hsa-miR-4495	CLIP-seq
MIRT1009598	hsa-miR-4516	CLIP-seq
MIRT1009599	hsa-miR-4531	CLIP-seq
MIRT1009600	hsa-miR-4635	CLIP-seq
MIRT1009601	hsa-miR-4699-3p	CLIP-seq
MIRT1009602	hsa-miR-4717-3p	CLIP-seq
MIRT1009603	hsa-miR-4802-3p	CLIP-seq
MIRT1009604	hsa-miR-488	CLIP-seq
MIRT1009605	hsa-miR-497	CLIP-seq
MIRT1009606	hsa-miR-526b	CLIP-seq
MIRT1009607	hsa-miR-532-5p	CLIP-seq
MIRT1009608	hsa-miR-539	CLIP-seq
MIRT1009557	hsa-miR-548a-5p	CLIP-seq
MIRT1009558	hsa-miR-548ab	CLIP-seq
MIRT1009559	hsa-miR-548ak	CLIP-seq
MIRT1009560	hsa-miR-548b-5p	CLIP-seq
MIRT1009561	hsa-miR-548c-5p	CLIP-seq
MIRT1009562	hsa-miR-548d-5p	CLIP-seq
MIRT1009564	hsa-miR-548h	CLIP-seq
MIRT1009565	hsa-miR-548i	CLIP-seq
MIRT1009566	hsa-miR-548j	CLIP-seq
MIRT1009567	hsa-miR-548n	CLIP-seq
MIRT1009609	hsa-miR-548t	CLIP-seq
MIRT1009568	hsa-miR-548w	CLIP-seq
MIRT1009569	hsa-miR-548y	CLIP-seq
MIRT1009570	hsa-miR-559	CLIP-seq
MIRT1009610	hsa-miR-570	CLIP-seq
MIRT1009571	hsa-miR-590-3p	CLIP-seq
MIRT1009574	hsa-miR-607	CLIP-seq
MIRT1999125	hsa-miR-1273e	CLIP-seq
MIRT1999126	hsa-miR-1276	CLIP-seq
MIRT1009587	hsa-miR-3148	CLIP-seq
MIRT1009534	hsa-miR-3671	CLIP-seq
MIRT1009535	hsa-miR-369-3p	CLIP-seq
MIRT1009536	hsa-miR-374a	CLIP-seq
MIRT1009537	hsa-miR-374b	CLIP-seq
MIRT1999127	hsa-miR-4311	CLIP-seq
MIRT1009597	hsa-miR-4495	CLIP-seq
MIRT1999128	hsa-miR-583	CLIP-seq
MIRT1999129	hsa-miR-595	CLIP-seq
MIRT1009574	hsa-miR-607	CLIP-seq
MIRT1009587	hsa-miR-3148	CLIP-seq
MIRT1009610	hsa-miR-570	CLIP-seq
MIRT1009584	hsa-miR-23a	CLIP-seq
MIRT1009585	hsa-miR-23b	CLIP-seq
MIRT1009586	hsa-miR-23c	CLIP-seq
MIRT2232827	hsa-miR-3158-3p	CLIP-seq
MIRT2232828	hsa-miR-3614-3p	CLIP-seq
MIRT2232829	hsa-miR-3667-3p	CLIP-seq
MIRT2232830	hsa-miR-3685	CLIP-seq
MIRT2232831	hsa-miR-3692	CLIP-seq
MIRT2232832	hsa-miR-374c	CLIP-seq
MIRT2232833	hsa-miR-377	CLIP-seq
MIRT2232834	hsa-miR-384	CLIP-seq
MIRT2232835	hsa-miR-4297	CLIP-seq
MIRT2232836	hsa-miR-4446-3p	CLIP-seq
MIRT2232837	hsa-miR-4494	CLIP-seq
MIRT2232838	hsa-miR-452	CLIP-seq
MIRT1009544	hsa-miR-4643	CLIP-seq
MIRT1009546	hsa-miR-466	CLIP-seq
MIRT2232839	hsa-miR-4676-3p	CLIP-seq
MIRT2232840	hsa-miR-4719	CLIP-seq
MIRT1009554	hsa-miR-4789-3p	CLIP-seq
MIRT2232841	hsa-miR-579	CLIP-seq
MIRT2232842	hsa-miR-655	CLIP-seq
MIRT2429180	hsa-miR-4729	CLIP-seq
MIRT2232841	hsa-miR-579	CLIP-seq
MIRT1009536	hsa-miR-374a	CLIP-seq
MIRT1009537	hsa-miR-374b	CLIP-seq
MIRT2536436	hsa-miR-3200-5p	CLIP-seq
MIRT2536437	hsa-miR-383	CLIP-seq
MIRT2536438	hsa-miR-3908	CLIP-seq
MIRT2536439	hsa-miR-3942-5p	CLIP-seq
MIRT2536440	hsa-miR-4679	CLIP-seq
MIRT2536441	hsa-miR-4699-5p	CLIP-seq
MIRT2536442	hsa-miR-4703-5p	CLIP-seq
MIRT2536443	hsa-miR-4704-3p	CLIP-seq
MIRT1009550	hsa-miR-4727-5p	CLIP-seq
MIRT2536444	hsa-miR-4766-3p	CLIP-seq
MIRT2536445	hsa-miR-4772-5p	CLIP-seq
MIRT1009554	hsa-miR-4789-3p	CLIP-seq
MIRT2681307	hsa-miR-3154	CLIP-seq
MIRT2536436	hsa-miR-3200-5p	CLIP-seq
MIRT2681308	hsa-miR-3682-3p	CLIP-seq
MIRT2536437	hsa-miR-383	CLIP-seq
MIRT2536438	hsa-miR-3908	CLIP-seq
MIRT2536439	hsa-miR-3942-5p	CLIP-seq
MIRT2681309	hsa-miR-4282	CLIP-seq
MIRT2681310	hsa-miR-4517	CLIP-seq
MIRT2536440	hsa-miR-4679	CLIP-seq
MIRT2536441	hsa-miR-4699-5p	CLIP-seq
MIRT2536442	hsa-miR-4703-5p	CLIP-seq
MIRT2536443	hsa-miR-4704-3p	CLIP-seq
MIRT2536444	hsa-miR-4766-3p	CLIP-seq
MIRT2536445	hsa-miR-4772-5p	CLIP-seq
MIRT1009554	hsa-miR-4789-3p	CLIP-seq
MIRT2681311	hsa-miR-4796-5p	CLIP-seq
MIRT1009571	hsa-miR-590-3p	CLIP-seq
MIRT2681312	hsa-miR-654-3p	CLIP-seq
MIRT2681313	hsa-miR-889	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
ATF1	Unknown	10585419
CREB1	Unknown	10585419

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	IDA	22306510
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	9857059
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	12750007, 22306510
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	12750007, 22306510
GO:0001701	Process	In utero embryonic development	IEA
GO:0001825	Process	Blastocyst formation	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	7590737
GO:0005515	Function	Protein binding	IPI	10675337, 16624878, 24501276, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9857059
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9016666
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045653	Process	Negative regulation of megakaryocyte differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9857059
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12750007, 22306510, 24501276
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
600609	4071	ENSG00000154727

Q06546

Protein name

GA-binding protein alpha chain (GABP subunit alpha) (Nuclear respiratory factor 2 subunit alpha) (Transcription factor E4TF1-60)

Protein function

Transcription factor capable of interacting with purine rich repeats (GA repeats). Positively regulates transcription of transcriptional repressor RHIT/ZNF205 (PubMed:22306510). ; (Microbial infection) Nec

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF11620	GABP-alpha	36 → 119	GA-binding protein alpha chain	Family
PF02198	SAM_PNT	170 → 251	Sterile alpha motif (SAM)/Pointed domain	Domain
PF00178	Ets	321 → 400	Ets-domain	Domain

Sequence

MTKREAEELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQ
CSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTV
EVVIDPDAHHAESEAHLVEEAQVITLDGTKHITTISDETSEQVTRWAAALEGYRKEQERL
GIPYDPIQWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEIL
WSHLELLRKYVLASQEQQMNEIVTIDQPVQIIPASVQSATPTTIKVINSSAKAAKVQRAP
RISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKW
GQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVTE
CEQKKLAKMQLHGIAQPVTAVALATASLQTEKDN

Sequence length

454

Interactions

View interactions

	Reactome
			Transcriptional activation of mitochondrial biogenesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (394)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
ABLEPHARON-MACROSTOMIA SYNDROME	Ablepharon macrostomia syndrome	BEFREE	23722164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	25323587, 28505160, 30623427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	29854090, 29870787, 30174606, 30798137, 31127077, 31781326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	15657364, 25003661, 29597191, 31032633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	20347035, 21489257, 24040073, 27567474, 28049629, 28849259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	24040073, 26078725, 26385919, 26923328, 28104435, 28604754, 28967920, 29486183, 29526543, 30333878, 30411339, 30556750, 31040157, 31717324, 31839815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	30597358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	26588861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	29947925, 29997171, 31340446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	30112024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	24440594, 28103505, 28253482, 30253279, 30455645, 31271759, 31601909, 31781321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alexander Disease	Alexander Disease	BEFREE	22693571, 22855800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	29636694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	30919246, 30968880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	28421738, 30235892, 31503421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	18957896, 19074031, 22353756, 23418589, 23732987, 24102512, 24672634, 25822630, 27439389, 28334913, 30565312, 30617737, 30954537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	19074031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	20709907, 30060095, 30755497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	20709907, 21483798, 26914345, 28899203, 29255069, 30412705, 30674214, 31015205, 31404577, 31408727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	30135655		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26915435, 27167341, 27750041, 29232549, 30302023, 31243599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	26733011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	26733011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	29743974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	30025621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	15917255, 17673673, 26054672, 26510581, 28189649, 29187515, 29917052, 30170173, 30601695, 30897380, 31031630, 31632534, 31645538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29233793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	28408162, 31710683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	31830562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	BEFREE	26823733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20805158, 21051083, 21799075, 23622008, 24783956, 26369337, 28624471, 30092299, 30312763, 30729848, 31100413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	29441509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	31107893		★★★★★ ★☆☆☆☆ Found in Text Mining only
ATAXIA, EARLY-ONSET, WITH OCULOMOTOR APRAXIA AND HYPOALBUMINEMIA	Ataxia-oculomotor apraxia	BEFREE	25976310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	15917255, 17673673, 26054672, 26510581, 28189649, 29187515, 29917052, 30170173, 30601695, 30897380, 31031630, 31632534, 31645538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30120881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	30790585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	29034470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	15032691, 28507037, 30625116, 31345729, 31446053		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29297235, 29538305, 29658582, 29697268, 30569096, 30605065, 30664159, 30890112, 31250159, 31599449, 31717324		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	29709906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	22503981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behavior Disorders	Behavior Disorders	BEFREE	29214257, 30205995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	27187376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	31412319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	18692501, 31590928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder neck obstruction	Bladder neck obstruction	BEFREE	30140361, 31316719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23259779, 24837013, 29248722, 30241031, 31802036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	29864937, 30105924, 31352786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	18981988, 27187376, 30942197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17726138, 17822677, 19638449, 19940992, 20623181, 22964583, 24302665, 24366869, 24486718, 24491031, 25071010, 25154499, 25172557, 25226504, 25589623 View all (24 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26517092, 7914192	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	31561304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchitis	Bronchitis	BEFREE	30471087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	28667068, 29368550, 31713992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	26962150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	22767273, 24086340, 29469959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35958019	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23259779, 24837013, 24919441, 29248722, 31802036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	31293646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18006113, 18316592, 19417020, 19646463, 20689807, 21402146, 21964605, 23545629, 23572560, 23577226, 23689140, 23947958, 24040073, 24928441, 25070488 View all (23 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	20530669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21676886, 22378150, 23404377, 25270772, 28112439, 30166520, 30311581, 31472965, 31616183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	21126175, 28778483, 28942082, 29353218, 29693453, 30096613, 31173878, 31706979, 31712965, 31726716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	28673009, 29147465, 29327811, 29392616, 29408448, 30349977, 30619098, 31270951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	19530984, 20837051, 21626108, 25564368, 28189649, 28573503, 29104732, 29113088, 29187515, 29228553, 30170173, 31031630, 31099320, 31181253, 31332605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	30135571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	28722304, 29399076, 31173182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	27812888, 28169530, 28419990, 28956063, 29103101, 29383122, 29750875, 29917204, 30024618, 31283926, 31378909, 31389456, 31494826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	26846360, 27696223, 28169530, 28646795, 29628876, 29688134, 30890934, 31494826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	27226772, 31336872		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21842204, 28261610, 30058679, 31136958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	26247201, 29763899, 30796317, 31173751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21842204, 28261610, 30058679, 31136958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	24528044, 25708948, 29518609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	BEFREE	30825315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	BEFREE	30825315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	28553227, 29849889, 31637886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic colitis	Colitis	BEFREE	27683801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	28636290, 30462567, 31181253, 31601682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	22200442, 30070341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	22200442, 22874821, 24480117, 25140450, 25585822, 26490557, 26915483, 27789056, 28494744, 28561324, 28887058, 29205354, 29367259, 29452888, 29983865 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	20534903, 20594977, 21318260, 21459041, 21490276, 26861788, 27555763, 27832175, 28006950, 28347799, 28749079, 29547002, 29631592, 29659176, 29927029 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	28333129		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	28042770, 30890934, 31336872, 31411465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	27761760, 29036636, 29083257, 29125494, 29689442, 30461032, 31164420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	23494124, 24311782, 28987717, 29887940, 29891588, 30284461, 30426485, 31534619, 31628914, 31825438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19524433, 19734940, 22526619, 24311782, 24556415, 25226504, 28503853, 28737825, 30166520, 30249028, 30407216, 30473361, 30924710, 30974805, 31777421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	19734940, 21278237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22325485, 23455180, 25712056, 26899729, 27033953, 27636860, 27999449, 28542357, 28621229, 29693091, 29793178, 29808795, 29930754, 30365132, 30396944 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	25708948, 29518609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	25101151, 28373008, 28636290, 29373037, 29495326, 30462567, 30858063, 30864233, 31181253, 31556830, 31601682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28061437, 29983865, 30799949, 30896860, 31186733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Diseases	Corneal Diseases	BEFREE	29209447		★★★★★ ★☆☆☆☆ Found in Text Mining only
CORNEAL ENDOTHELIAL DYSTROPHY 2	CORNEAL ENDOTHELIAL DYSTROPHY	BEFREE	28642546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	24373961, 29104636, 29849452, 30468811, 31082959, 31332605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	24373961, 31332605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	24373961, 29845299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	22467641, 31145101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	27463229, 28237856, 28259976, 28662306, 28684418, 28933476, 28957964, 29138829, 29339024, 29765450, 30015238, 30176344, 30248539, 30931327, 31228817 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	26115075, 28107678, 30981879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	30382185, 30642751, 31025223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	23623252		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	27646262, 27801891, 28763303, 30399591, 30776601, 31398773		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis	Dermatitis	BEFREE	27242339, 28219650, 28912452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	27871981, 31257541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	24503019, 29277538, 30293051, 31079103, 31492195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	30742662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	21161163, 21439933, 23050040, 23834171, 24186494, 24740756, 25016074, 27840317, 28012783, 28343084, 28457936, 29346597, 29367259, 29634312, 29781726 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	21161163, 21439933, 23050040, 23834171, 24186494, 24740756, 25016074, 25528168, 27840317, 28012783, 28343084, 28457936, 29346597, 29367259, 29634312 View all (18 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28700700, 28842399, 29154192, 30119216, 30359563, 30537423, 30551471, 30625116, 30779107, 31244660, 31546235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20524845, 21861804, 25046864, 25511473, 27903744, 28642811, 28646795, 28684418, 28700700, 28913364, 29143802, 29227493, 30022432, 30208622, 30803422 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	27457280, 27903744, 28677741, 29404371, 30971629, 31009852, 31270951, 31323227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	20103708, 22025779, 23050040, 25046864, 26849944, 27799462, 28033563, 28286065, 28373900, 28457936, 28501426, 28595780, 28704754, 29161661, 29248720 View all (18 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	21439933, 28353124, 29094308, 30045011, 30536411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	24186494, 25016074, 28012783, 29411009, 30606939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	30112024, 30755497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	30594664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	30028071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Drusen	Drusen	BEFREE	24440594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	17982693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Early infantile epileptic encephalopathy with suppression bursts	Epileptic Encephalopathy	BEFREE	29684505		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	20530669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	31257541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	28747068, 29223100		★★★★★ ★☆☆☆☆ Found in Text Mining only
End Stage Liver Disease	End Stage Liver Disease	BEFREE	26459724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	20530669, 21897267, 28386373, 30711933, 30908539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	26824415, 28638475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34306255	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	28457937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	25774506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	23686862, 28412310, 29357320, 31019649		★★★★★ ★☆☆☆☆ Found in Text Mining only
EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 2	Epileptic encephalopathy	BEFREE	26006105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	21676886, 23404377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	30454888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	29282639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial benign pemphigus	Benign Pemphigus	BEFREE	29925776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	28300788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	21504366, 27837167, 28386616, 28419832, 29309075, 30057681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	23592516, 23822105, 26679056, 26919834, 27634173, 27984800, 28189916, 29276215, 29355950, 30180301, 30191499, 30248539, 31043271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	20518088, 23592516, 23793039, 26918567, 27477297, 27936457, 28423499, 28434817, 28437886, 28601022, 28665955, 28826090, 29078262, 29174446, 29307993, 29844659, 30464391, 31819135 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	21376112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	28211606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Friedreich Ataxia	BEFREE	23350650, 29057804, 31118567		★★★★★ ★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	23350650, 23574943, 30065630, 31031004, 31640150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	30954537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	22836768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fulminant hepatitis	Fulminant Hepatitis	BEFREE	25916679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	18692501, 30822690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	17982693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	31132430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	17562481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroparesis	Gastroparesis	BEFREE	21605664, 30831189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	31468582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	28081465, 30637543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23006842, 23708697, 24078215, 24374745, 25226504, 25304134, 27148686, 28260004, 29128799, 31444413, 31802036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23006842, 23708697, 24078215, 24374745, 25226504, 27148686, 28260004, 29128799, 31444413, 31802036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23128449, 25851054, 27187376, 28427200, 28685346, 28782555, 28805788, 31444413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid-remediable aldosteronism	Hyperaldosteronism	BEFREE	30208622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucose Metabolism Disorders	Glucose Metabolism Disorders	BEFREE	29285131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hair Diseases	Hair Diseases	BEFREE	28685843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	31768045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Harlequin Fetus	Harlequin Ichthyosis	BEFREE	30560518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	27544755, 27550943, 27733046, 28012440, 30339884, 31470592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	22938199, 30346043, 31712965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	25101151, 28373008, 29495326, 30858063, 30864233, 31556830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	BEFREE	27936457		★★★★★ ★☆☆☆☆ Found in Text Mining only
HEMOCHROMATOSIS, TYPE 1	Hemochromatosis	BEFREE	27936457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	31351363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Veno-Occlusive Disease	Hepatic veno-occlusive disease-immunodeficiency syndrome	BEFREE	29458270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	27734029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	28785378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	27936457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemorrhagic telangiectasia	Hereditary Hemorrhagic Telangiectasia	BEFREE	31270017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Leiomyomatosis and Renal Cell Cancer	Hereditary Leiomyomatosis and Renal Cancer	BEFREE	23365135, 26551707, 29302811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Malignant Neoplasm	Hereditary cancer	BEFREE	26551707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	24904228, 26490557, 29151180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	22138129, 23469253, 24904228, 26490557, 28533375, 29121340, 29151180, 29323772, 30391672, 30853569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	31206177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	28834687, 30463003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	25016074, 27497668, 27840317, 28040599, 28098811, 28254022, 28353124, 29655866, 29849938, 30359759, 30400057, 30473664, 31639451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	29608906, 30105650, 30949917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	30248482, 31485663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	BEFREE	21177379, 30409900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia Familial Combined	Hyperlipidemia	Pubtator	18230803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperphosphatemia (disorder)	Hyperphosphatemia	BEFREE	28513870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	27223823, 27226772, 28842207, 28906458, 29167164, 29211853, 31332605, 31416234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	31281590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	25807533, 30248482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	30565690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	30460866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31195886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28420366, 31611754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	22020111, 27761760, 28974442, 29036636, 29083257, 29113796, 29441016, 29474348, 29684505, 29689442, 29793180, 29849815, 29905772, 29961403, 30159112 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	24311782, 30182837, 31434263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	28219650, 28912452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	30358118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	30779107, 31546235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	31220996, 31585542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	31541481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intravascular hemolysis	Intravascular Hemolysis	BEFREE	29205354, 31333462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	27936457, 29135935, 31198069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28132764, 28162056, 29338172, 29628876, 30323140, 30890934, 31812555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	25995248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	30474788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	30106111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoderma, Palmoplantar	Palmoplantar keratoderma	BEFREE	27183391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	30599261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	23220723, 27804998, 28061437, 28494744, 28502971, 28791341, 29064158, 29211853, 29393366, 30248418, 30876865, 31059771, 31279986, 31372933, 31488013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	27789056, 28347910, 28494744, 28586635, 28928081, 29068550, 29104636, 29522116, 30178867, 31037316, 31333462, 31349118, 31849693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	22200442, 30070341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	30647407		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	23820265, 25918581, 27196781, 29118925, 30171828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	21212410, 23077289, 25323587, 28505160, 30142422, 30623427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	31527445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	24086340, 28529569, 31715238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15477009, 20127517, 21482715, 24203292, 25058527, 25556489, 25783764, 25896253, 26194347, 27091842, 27211490, 27213353, 27345495, 27404485, 27650414 View all (27 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	24636985, 28333129, 29852187, 31183386, 31386899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	26459724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	29331651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	29715757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	15477009, 27734029, 28655791, 30619751, 31637886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	19027064, 19646463, 22686525, 24783956, 30610225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	21177379, 25339352, 27847554, 28967920, 29526543, 29634345, 31126053, 31257027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	20507872, 30466076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	24025640, 31023362, 31311094, 31698204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	29247688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	31129156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	29119264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	25851054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	27544755, 27550943, 27733046, 28012440, 30339884, 31470592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	25896339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17726138, 17822677, 19638449, 19940992, 20623181, 22964583, 24302665, 24366869, 24486718, 24491031, 25071010, 25154499, 25172557, 25589623, 25976679 View all (26 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	20530669, 21897267, 28386373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	29243822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	18692501, 30822690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	28061437, 31372933, 31752777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	20722399, 28627706, 28655791, 29223570, 30251384, 31097586, 31840883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18006113, 18316592, 19417020, 19646463, 20689807, 21964605, 22249257, 23545629, 23572560, 23577226, 23689140, 23947958, 24040073, 24928441, 25070488 View all (24 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	24086340, 28529569, 31715238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23404377, 25270772, 28112439, 30166520, 30311581, 31472965, 31616183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21489257, 21734707, 24366069, 26117456, 26682003, 26980696, 27167341, 29240881, 29701272, 29765509, 29849873, 30355620, 30355942, 30972876, 31121848, 31511020, 31704815 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20729872, 21837756, 24121106, 25266896, 25728635, 26227317, 27788496, 28978049, 29228771, 29368435, 29383876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	19967722, 25804610, 28125038, 29603113, 31254216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28344324, 29091877, 30504425, 30811526, 31629709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	24138990, 29901070, 31428048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23259779, 24837013, 24919441, 29248722, 31802036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15252150, 15572695, 16054659, 16435293, 16543142, 17015834, 17129360, 18036733, 18048326, 18692501, 18757741, 18838122, 19050705, 19321346, 19608619 View all (169 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	22767273, 29306329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21842204, 28261610, 30058679, 31136958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19524433, 19734940, 22526619, 24311782, 24556415, 28503853, 28737825, 30166520, 30249028, 30407216, 30473361, 30924710, 30974805, 31777421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25398768, 25451081, 29729523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	31687076		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24491031, 27045471, 28108517, 29487283, 29670684, 31687076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	28108517	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	31802848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	29501041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	27187376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27646262, 27801891, 28763303, 30399591, 30776601, 31398773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	22019695, 23187004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	18230803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28722145, 30352880, 30610225, 31031630, 31396308, 31434263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28440735, 28608901, 30987086, 31366177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	25857617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	18332166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	29743487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	30386243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	16909019, 22353756, 28334913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	26393425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	29031566, 30405034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	19187944, 27277809, 28156185, 28623000, 28899203, 29494741, 31529356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	28472288, 29458173		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	30262569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	25397683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	28150717, 28267438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28373008, 28438659, 28964663, 29110132, 29975120, 31052164, 31201843, 31351363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	29104636, 29849452, 30468811, 31082959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	29428410, 31601682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17234762, 19751820, 20440267, 20530669, 20707922, 21278237, 21482715, 21489257, 21734707, 21842204, 21897267, 21969819, 22387177, 22526619, 22684020 View all (103 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	20507872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	22215675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrogenic Diabetes Insipidus	Nephrogenic Diabetes Insipidus	BEFREE	28233855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	30599261		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	22855800, 26164630, 29969760, 30778297, 30790585, 31336872, 31784171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11162512, 14985350, 18273910, 19573594, 20028456, 22020111, 22142473, 24005795, 25661352, 27023064, 27389776, 27686076, 27696114, 28000163, 28073699 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	19573594, 20202476, 20446769, 21499987, 22227268, 22693571, 23574943, 24382478, 25280871, 26617217, 27554286, 27841081, 28104575, 28253260, 28271112 View all (23 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	29143802, 30592963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy, Painful	Neuropathy	BEFREE	29143802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	30529165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	26120584, 28189916, 28796629, 28932253, 29860219, 30867696, 31076985, 31775341, 31838177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17020408, 19345732, 19638449, 19940992, 20446773, 20534738, 20682644, 21610322, 21964605, 22249257, 22684019, 22684020, 24556415, 24571482, 26343532 View all (26 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	22364184, 23592516, 26679056, 26919834, 27404485, 27634173, 29276215, 30279623, 30684890, 31514051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	20089859, 21161163, 28254022, 28277986, 28420087, 28440735, 29129772, 29486138, 29566366, 29905772, 30831189, 31031630, 31231489, 31595164, 31817423, 31823672 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	25172557, 28416489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Opitz GBBB Syndrome, X-Linked	Opitz GBBB Syndrome, X-Linked	BEFREE	29684505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	31676390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	29494741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	22841931, 23612225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthrosis Deformans	Osteoarthrosis Deformans	BEFREE	30474788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	30550742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28515152, 29710518, 30742845, 31038249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29545917, 30030965, 30905781, 31004750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28010924, 31409554		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	23404377, 25270772, 28112439, 30166520, 30311581, 31472965, 31616183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pachyonychia Congenita	Pachyonychia Congenita	BEFREE	27183391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21489257, 21734707, 24366069, 26117456, 26682003, 26980696, 27167341, 29240881, 29701272, 29765509, 29849873, 30355620, 30355942, 30972876, 31121848, 31511020, 31704815 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	26915435, 27750041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	21489257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	30248482, 30798137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	31688588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	23365135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary renal cell carcinoma type 2	Papillary Renal Carcinoma	BEFREE	23365135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23766517, 24138990, 26721202, 29469959, 29901070, 30181547, 30697724, 31428048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	17015834, 19236154, 20196834, 21747966, 22513881, 23054368, 23106139, 25496089, 26010367, 26282218, 26526034, 26537816, 27277809, 27810365, 28028237 View all (28 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	31307745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	30565690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	29128794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	28513573, 28617616, 30622677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	29540636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	29530794, 30592963, 30881589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	29530794, 30592963, 30881589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Piebaldism	Piebaldism	BEFREE	27187376, 30942197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	BEFREE	30118661, 31552548		★★★★★ ★☆☆☆☆ Found in Text Mining only
PNEUMOTHORAX, PRIMARY SPONTANEOUS	Pneumothorax	BEFREE	28932556, 28962820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	29515258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	20055754, 28333129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary malignant neoplasm of brain	Brain Neoplasms	BEFREE	28805788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	25397683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	30825315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progeria	Progeria	BEFREE	28229933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	29860433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20729872, 21837756, 24121106, 25266896, 25728635, 26227317, 27788496, 28978049, 29228771, 29368435, 29383876		★★★★★ ★☆☆☆☆ Found in Text Mining only
prostatitis	Prostatitis	BEFREE	28844677		★★★★★ ★☆☆☆☆ Found in Text Mining only
PSEUDOHYPOALDOSTERONISM, TYPE IID	Pseudohypoaldosteronism	BEFREE	31313673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	24852654, 28576737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	28918452, 31710683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	30563490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Cystic Fibrosis	Pulmonary Cystic Fibrosis	BEFREE	28062182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	15520857, 19671143, 21318260, 24783956, 27555763, 28006950, 28347799, 28886998, 29659176, 31297601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	27436123, 29108993, 29362432, 29864937, 30219680, 30474696, 31301076, 31611754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	28061437, 31372933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28061437, 29983865, 30896860, 31186733, 31752777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	23056222, 27840317, 28286065, 29248720, 29621130, 30431100, 30925687, 31059771, 31632538, 31768838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	21376112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	28286065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	24783956, 30728889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	28905450, 29512754, 29684352, 29805514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	24783956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	23717650, 30701326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	27744121, 28898138, 29656207, 29852739, 30538709, 31475364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	23052169, 29515034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	31278495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seborrheic dermatitis	Seborrheic dermatitis	BEFREE	24503019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	17822364, 26253656, 27718499, 27899278, 29887956, 30034396, 30250973, 30465941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	24107458, 27183391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	25804610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	29042934, 30159112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	23667609		★★★★★ ★☆☆☆☆ Found in Text Mining only
SPHEROCYTOSIS, TYPE 1 (disorder)	Spherocytosis	BEFREE	26935388		★★★★★ ★☆☆☆☆ Found in Text Mining only
SPINOCEREBELLAR ATAXIA 17	Spinocerebellar Ataxia	BEFREE	24413982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spontaneous pneumothorax	Spontaneous pneumothorax	BEFREE	28962820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19967722, 24386210, 25739673, 29306329, 30411339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	24028437, 29675925, 29752726, 31755241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	23545629, 25739673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	28887499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	24596130, 30376862, 31575007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	23686862, 28386312, 30592708, 30714645, 31574956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	21504366, 27837167, 28386616, 28419832, 28555106, 28796629, 29309075, 30057681, 30807179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28344324, 29091877, 29110625, 30504425, 30811526, 31629709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32468960	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28928429, 29563984, 30890112, 31191800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28027929, 30177933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	24277722, 28148553, 28704727, 29121589, 29860433, 30029164, 30769286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	29054545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	31705858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer follicular	Follicular thyroid cancer	Pubtator	32163919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	24138990, 29901070, 30181547, 31428048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	31267862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	24138990, 29901070, 31428048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	30664813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	29628876, 29685007, 29688134, 29750875, 30334406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	29628876, 29685007, 29688134, 29750875, 30334406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26536456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	31506280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tyrosinemias	Tyrosinemia	BEFREE	26551707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	28050757, 28922365, 29518435, 29661352, 29710547, 29887940, 29941222, 30149369, 30530041, 30594690, 31326516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	29119264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	28767070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	28684304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	29138814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	17255530, 20524845, 22575091, 25009787, 28429615, 28465407, 28542559, 31769924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	18537816, 27222475, 28174051, 28186139, 28836394, 29199612, 30338917, 31115551		★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	18537816, 27222475, 28174051, 28186139, 28836394, 29199612, 30338917, 31115551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Young onset Parkinson disease	Parkinson disease	BEFREE	24284401		★★★★★ ★☆☆☆☆ Found in Text Mining only

GABPA (GA binding protein transcription factor subunit alpha)