Gene Gene information from NCBI Gene database.
Entrez ID 2548
Gene name Alpha glucosidase
Gene symbol GAA
Synonyms (NCBI Gene)
LYAG
Chromosome 17
Chromosome location 17q25.3
Summary This gene encodes lysosomal alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. The encoded preproprotein is proteolytically processed to generate multiple intermediate forms and the mature form of the enzyme. De
SNPs SNP information provided by dbSNP.
278
SNP ID Visualize variation Clinical significance Consequence
rs1800309 G>A,C Benign-likely-benign, other, pathogenic, benign Coding sequence variant, genic downstream transcript variant, missense variant
rs1800312 G>A,C Pathogenic, pathogenic-likely-pathogenic Coding sequence variant, genic downstream transcript variant, stop gained, missense variant
rs2229224 G>A,T Conflicting-interpretations-of-pathogenicity Coding sequence variant, genic downstream transcript variant, missense variant
rs2304846 G>A Conflicting-interpretations-of-pathogenicity, uncertain-significance Coding sequence variant, genic downstream transcript variant, synonymous variant
rs28937909 G>A,T Pathogenic Genic downstream transcript variant, missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
52
miRTarBase ID miRNA Experiments Reference
MIRT079203 hsa-miR-92a-3p HITS-CLIP 22473208
MIRT079207 hsa-miR-92b-3p HITS-CLIP 22473208
MIRT079202 hsa-miR-32-5p HITS-CLIP 22473208
MIRT1009120 hsa-miR-1228 CLIP-seq
MIRT1009121 hsa-miR-125a-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
51
GO ID Ontology Definition Evidence Reference
GO:0000023 Process Maltose metabolic process IC 9505277
GO:0002026 Process Regulation of the force of heart contraction IEA
GO:0002086 Process Diaphragm contraction IEA
GO:0002086 Process Diaphragm contraction IMP 16917947
GO:0003007 Process Heart morphogenesis IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606800 4065 ENSG00000171298
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P10253
Protein name Lysosomal alpha-glucosidase (EC 3.2.1.20) (Acid maltase) (Aglucosidase alfa) [Cleaved into: 76 kDa lysosomal alpha-glucosidase; 70 kDa lysosomal alpha-glucosidase]
Protein function Essential for the degradation of glycogen in lysosomes (PubMed:14695532, PubMed:18429042, PubMed:1856189, PubMed:7717400). Has highest activity on alpha-1,4-linked glycosidic linkages, but can also hydrolyze alpha-1,6-linked glucans (PubMed:2906
PDB 5KZW , 5KZX , 5NN3 , 5NN4 , 5NN5 , 5NN6 , 5NN8 , 7P2Z , 7P32
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00088 Trefoil 82 130 Trefoil (P-type) domain Domain
PF16863 NtCtMGAM_N 147 253 N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase Domain
PF13802 Gal_mutarotas_2 254 320 Galactose mutarotase-like Domain
PF01055 Glyco_hydro_31 340 824 Glycosyl hydrolases family 31 Family
Sequence
MGVRHPPCSHRLLAVCALVSLATAALLGHILLHDFLLVPRELSGSSPVLEETHPAHQQGA
SRPGPRDAQAHPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLQGA
QMGQPWCFFP
PSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLH
FTIKDPANRRYEVPLETPHVHSRAPSPLYSVEFSEEPFGVIVRRQLDGRVLLNTTVAPLF
FADQFLQLSTSLP
SQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANLYGSHPFYLA
LEDGGSAHGVFLLNSNAMDV
VLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGY
PFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDG
FRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKV
WPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPNNELEN
PPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLYGLTEAIASHRALVKARGTRPFVISR
STFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVR
WTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAG
ETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPV
EALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYII
PLQGPGLTTTESRQQP
MALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGLQ
LQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSWC
Sequence length 952
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Lysosome
  Glycogen storage disease type II (GAA)
Neutrophil degranulation
Glycogen breakdown (glycogenolysis)
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
57
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Abnormality of metabolism/homeostasis Pathogenic rs753269119 RCV001814152
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cardiovascular phenotype Likely pathogenic; Pathogenic rs2143931061, rs528367092, rs757700700, rs772883420, rs781088002, rs386834236, rs28940868, rs121907943, rs764622267, rs1800312, rs142967546, rs375470378, rs61736895, rs1278340100 RCV005831967
RCV004020013
RCV005562312
RCV005338091
RCV005562311
View all (9 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Cervical cancer Pathogenic rs386834236 RCV005887285
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Clear cell carcinoma of kidney Pathogenic rs143523371 RCV005895485
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acid alpha-glucosidase, allele 2 Benign; Likely benign; other ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Acid alpha-glucosidase, allele 4 Benign; other ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Acute myeloid leukemia Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Acute rhabdomyolysis Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adult Glycogen Storage Disease Type II Glycogen Storage Disease CTD_human_DG 11328962, 15466083, 18176891, 21644219, 21963784
★☆☆☆☆
Found in Text Mining only
Agenesis of corpus callosum Agenesis Of Corpus Callosum BEFREE 9288786
★☆☆☆☆
Found in Text Mining only
Anaplastic thyroid carcinoma Anaplastic thyroid cancer BEFREE 9288786
★☆☆☆☆
Found in Text Mining only
Antiphospholipid Syndrome Antiphospholipid syndrome Pubtator 30711607 Associate
★☆☆☆☆
Found in Text Mining only
Aortic Aneurysm Aortic Aneurysm BEFREE 15536609
★☆☆☆☆
Found in Text Mining only
Aortic Aneurysm, Abdominal Aortic Aneurysm BEFREE 15536609
★☆☆☆☆
Found in Text Mining only
Aplasia Cutis Congenita Aplasia Cutis Congenita BEFREE 9288786
★☆☆☆☆
Found in Text Mining only
Ataxia Ataxia Pubtator 38150853 Associate
★☆☆☆☆
Found in Text Mining only
Ataxia Telangiectasia Ataxia Telangiectasia BEFREE 9288786
★☆☆☆☆
Found in Text Mining only
Atrial Fibrillation Atrial fibrillation Pubtator 37087815 Associate
★☆☆☆☆
Found in Text Mining only