Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	254359
Gene name	ZDHHC palmitoyltransferase 24
Gene symbol	ZDHHC24
Synonyms (NCBI Gene)	-
Chromosome	11
Chromosome location	11q13.2

Show/Hide all (59)

miRTarBase ID	miRNA	Experiments	Reference
MIRT664102	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT664101	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT664100	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT664099	hsa-miR-221-5p	HITS-CLIP	23824327
MIRT664098	hsa-miR-8073	HITS-CLIP	23824327
MIRT664097	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT664096	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT664095	hsa-miR-3128	HITS-CLIP	23824327
MIRT664094	hsa-miR-4252	HITS-CLIP	23824327
MIRT664093	hsa-miR-196a-3p	HITS-CLIP	23824327
MIRT664092	hsa-miR-1227-3p	HITS-CLIP	23824327
MIRT664091	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT664090	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT664089	hsa-miR-7703	HITS-CLIP	23824327
MIRT648030	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT648029	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT648028	hsa-miR-205-3p	HITS-CLIP	23824327
MIRT648027	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT648026	hsa-miR-136-5p	HITS-CLIP	23824327
MIRT648025	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT648024	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT648023	hsa-miR-587	HITS-CLIP	23824327
MIRT664089	hsa-miR-7703	PAR-CLIP	27292025
MIRT664102	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT664101	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT664100	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT664099	hsa-miR-221-5p	HITS-CLIP	23824327
MIRT664098	hsa-miR-8073	HITS-CLIP	23824327
MIRT664097	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT664096	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT664095	hsa-miR-3128	HITS-CLIP	23824327
MIRT664094	hsa-miR-4252	HITS-CLIP	23824327
MIRT664093	hsa-miR-196a-3p	HITS-CLIP	23824327
MIRT664092	hsa-miR-1227-3p	HITS-CLIP	23824327
MIRT664091	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT664090	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT664089	hsa-miR-7703	HITS-CLIP	23824327
MIRT648030	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT648029	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT648028	hsa-miR-205-3p	HITS-CLIP	23824327
MIRT648027	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT648026	hsa-miR-136-5p	HITS-CLIP	23824327
MIRT648025	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT648024	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT648023	hsa-miR-587	HITS-CLIP	23824327
MIRT1508557	hsa-miR-122	CLIP-seq
MIRT1508558	hsa-miR-1234	CLIP-seq
MIRT1508559	hsa-miR-224	CLIP-seq
MIRT1508560	hsa-miR-3130-3p	CLIP-seq
MIRT1508561	hsa-miR-3136-3p	CLIP-seq
MIRT1508562	hsa-miR-3690	CLIP-seq
MIRT1508563	hsa-miR-4308	CLIP-seq
MIRT1508564	hsa-miR-4468	CLIP-seq
MIRT1508565	hsa-miR-4638-3p	CLIP-seq
MIRT1508566	hsa-miR-4667-3p	CLIP-seq
MIRT1508567	hsa-miR-4688	CLIP-seq
MIRT1508568	hsa-miR-4722-3p	CLIP-seq
MIRT1508569	hsa-miR-483-3p	CLIP-seq
MIRT1508570	hsa-miR-486-3p	CLIP-seq

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005794	Component	Golgi apparatus	IBA
GO:0006612	Process	Protein targeting to membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016409	Function	Palmitoyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0019706	Function	Protein-cysteine S-palmitoyltransferase activity	IBA
GO:0019706	Function	Protein-cysteine S-palmitoyltransferase activity	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q6UX98

Protein name

Probable palmitoyltransferase ZDHHC24 (EC 2.3.1.225) (Zinc finger DHHC domain-containing protein 24)

Protein function

Probable palmitoyltransferase that could catalyze the addition of palmitate onto various protein substrates.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01529	DHHC	91 → 234	DHHC palmitoyltransferase	Family

Sequence

MGQPWAAGSTDGAPAQLPLVLTALWAAAVGLELAYVLVLGPGPPPLGPLARALQLALAAF
QLLNLLGNVGLFLRSDPSIRGVMLAGRGLGQGWAYCYQCQSQVPPRSGHCSACRVCILRR
DHHCRLLGRCVGFGNYRPFLCLLLHAAGVLLHVSVLLGPALSALLRAHTPLHMAALLLLP
WLMLLTGRVSLAQFALAFVTDTCVAGALLCGAGLLFHGMLLLRGQTTWEWARGQHSYDLG
PCHNLQAALGPRWALVWLWPFLASPLPGDGITFQTTADVGHTAS

Sequence length

284

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BARDET-BIEDL SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BARDET-BIEDL SYNDROME 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINITIS PIGMENTOSA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
USHER SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (19)

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Apraxia of Phonation	Apraxia	CLINVAR_DG		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	CLINVAR_DG		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astigmatism	Astigmatism	CLINVAR_DG		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bardet-Biedl Syndrome	Bardet-Biedl Syndrome	CLINVAR_DG	12118255, 12524598, 12677556, 12837689, 15314642, 15770229, 16327777, 17980398, 18032602, 18669544, 18766993, 20177705, 20498079, 20876674, 21517826 View all (10 more)	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bardet-Biedl syndrome 1 (disorder)	Bardet-Biedl Syndrome	CLINVAR_DG	12118255, 12524598, 12677556, 12920096, 15770229, 18032602, 20177705, 20498079, 20876674, 21052717, 21344540, 21517826, 21642631, 22581970, 22773737 View all (7 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	CLINVAR_DG		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachydactyly	Brachydactyly	CLINVAR_DG		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	CLINVAR_DG		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	CLINVAR_DG		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild Mental Retardation	Mental retardation	CLINVAR_DG		★★★★★ ★☆☆☆☆ Found in Text Mining only
obsolete Rod-cone dystrophy	Rod-cone dystrophy	CLINVAR_DG		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	CLINVAR_DG		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polydactyly	Polydactyly	CLINVAR_DG		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Dystrophies	Retinal Dystrophy	CLINVAR_DG	12118255, 26872967	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	CLINVAR_DG	12118255, 30718709	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Severe myopia	Myopia	CLINVAR_DG		★★★★★ ★☆☆☆☆ Found in Text Mining only
Syndactyly	Syndactyly	CLINVAR_DG		★★★★★ ★☆☆☆☆ Found in Text Mining only
Usher Syndrome	Usher Syndrome	CLINVAR_DG	30718709	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitamin B 12 Deficiency	Cobalamin deficiency	CLINVAR_DG		★★★★★ ★☆☆☆☆ Found in Text Mining only

ZDHHC24 (zDHHC palmitoyltransferase 24)