Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	2543
Gene name	G antigen 1
Gene symbol	GAGE1
Synonyms (NCBI Gene)	CT4.1CT4.4GAGE-1GAGE-4GAGE4
Chromosome	X
Chromosome location	Xp11.23
Summary	This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The antigenic pepti

170

Show/Hide all (170)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018221	hsa-miR-335-5p	Microarray	18185580
MIRT445285	hsa-miR-3681-5p	PAR-CLIP	22100165
MIRT445283	hsa-miR-6849-5p	PAR-CLIP	22100165
MIRT445282	hsa-miR-135a-5p	PAR-CLIP	22100165
MIRT445281	hsa-miR-135b-5p	PAR-CLIP	22100165
MIRT445280	hsa-miR-4649-3p	PAR-CLIP	22100165
MIRT445279	hsa-miR-5186	PAR-CLIP	22100165
MIRT445278	hsa-miR-3975	PAR-CLIP	22100165
MIRT445277	hsa-miR-2467-5p	PAR-CLIP	22100165
MIRT445276	hsa-miR-485-5p	PAR-CLIP	22100165
MIRT445275	hsa-miR-6884-5p	PAR-CLIP	22100165
MIRT445273	hsa-miR-3188	PAR-CLIP	22100165
MIRT445274	hsa-miR-1193	PAR-CLIP	22100165
MIRT445272	hsa-miR-3691-5p	PAR-CLIP	22100165
MIRT445271	hsa-miR-432-3p	PAR-CLIP	22100165
MIRT445285	hsa-miR-3681-5p	PAR-CLIP	22100165
MIRT445283	hsa-miR-6849-5p	PAR-CLIP	22100165
MIRT445282	hsa-miR-135a-5p	PAR-CLIP	22100165
MIRT445281	hsa-miR-135b-5p	PAR-CLIP	22100165
MIRT445280	hsa-miR-4649-3p	PAR-CLIP	22100165
MIRT445279	hsa-miR-5186	PAR-CLIP	22100165
MIRT445278	hsa-miR-3975	PAR-CLIP	22100165
MIRT445277	hsa-miR-2467-5p	PAR-CLIP	22100165
MIRT445276	hsa-miR-485-5p	PAR-CLIP	22100165
MIRT445275	hsa-miR-6884-5p	PAR-CLIP	22100165
MIRT445273	hsa-miR-3188	PAR-CLIP	22100165
MIRT445274	hsa-miR-1193	PAR-CLIP	22100165
MIRT445272	hsa-miR-3691-5p	PAR-CLIP	22100165
MIRT445271	hsa-miR-432-3p	PAR-CLIP	22100165
MIRT1010261	hsa-miR-10a	CLIP-seq
MIRT1010262	hsa-miR-10b	CLIP-seq
MIRT1010263	hsa-miR-1225-3p	CLIP-seq
MIRT1010264	hsa-miR-1227	CLIP-seq
MIRT1010265	hsa-miR-1233	CLIP-seq
MIRT1010266	hsa-miR-1257	CLIP-seq
MIRT1010267	hsa-miR-1262	CLIP-seq
MIRT1010268	hsa-miR-1275	CLIP-seq
MIRT1010269	hsa-miR-1285	CLIP-seq
MIRT1010270	hsa-miR-1294	CLIP-seq
MIRT1010271	hsa-miR-145	CLIP-seq
MIRT1010272	hsa-miR-147	CLIP-seq
MIRT1010273	hsa-miR-1825	CLIP-seq
MIRT1010274	hsa-miR-199a-5p	CLIP-seq
MIRT1010275	hsa-miR-199b-5p	CLIP-seq
MIRT1010276	hsa-miR-298	CLIP-seq
MIRT1010277	hsa-miR-3064-3p	CLIP-seq
MIRT1010278	hsa-miR-3121-3p	CLIP-seq
MIRT1010279	hsa-miR-3122	CLIP-seq
MIRT1010280	hsa-miR-3148	CLIP-seq
MIRT1010281	hsa-miR-3150b-3p	CLIP-seq
MIRT1010282	hsa-miR-3163	CLIP-seq
MIRT1010283	hsa-miR-3187-5p	CLIP-seq
MIRT1010284	hsa-miR-320e	CLIP-seq
MIRT1010285	hsa-miR-329	CLIP-seq
MIRT1010286	hsa-miR-34b	CLIP-seq
MIRT1010287	hsa-miR-3529	CLIP-seq
MIRT1010288	hsa-miR-362-3p	CLIP-seq
MIRT1010289	hsa-miR-3678-3p	CLIP-seq
MIRT1010290	hsa-miR-3688-3p	CLIP-seq
MIRT1010291	hsa-miR-3689a-3p	CLIP-seq
MIRT1010292	hsa-miR-3689c	CLIP-seq
MIRT1010293	hsa-miR-379	CLIP-seq
MIRT1010294	hsa-miR-3913-5p	CLIP-seq
MIRT1010295	hsa-miR-3929	CLIP-seq
MIRT1010296	hsa-miR-3941	CLIP-seq
MIRT1010297	hsa-miR-4310	CLIP-seq
MIRT1010298	hsa-miR-4418	CLIP-seq
MIRT1010299	hsa-miR-4419b	CLIP-seq
MIRT1010300	hsa-miR-4428	CLIP-seq
MIRT1010301	hsa-miR-4440	CLIP-seq
MIRT1010302	hsa-miR-4451	CLIP-seq
MIRT1010303	hsa-miR-4457	CLIP-seq
MIRT1010304	hsa-miR-4459	CLIP-seq
MIRT1010305	hsa-miR-4464	CLIP-seq
MIRT1010306	hsa-miR-4475	CLIP-seq
MIRT1010307	hsa-miR-4477b	CLIP-seq
MIRT1010308	hsa-miR-4478	CLIP-seq
MIRT1010309	hsa-miR-4525	CLIP-seq
MIRT1010310	hsa-miR-4536	CLIP-seq
MIRT1010311	hsa-miR-4643	CLIP-seq
MIRT1010312	hsa-miR-4650-3p	CLIP-seq
MIRT1010313	hsa-miR-466	CLIP-seq
MIRT1010314	hsa-miR-4665-5p	CLIP-seq
MIRT1010315	hsa-miR-4668-5p	CLIP-seq
MIRT1010316	hsa-miR-4679	CLIP-seq
MIRT1010317	hsa-miR-4689	CLIP-seq
MIRT1010318	hsa-miR-4701-3p	CLIP-seq
MIRT1010319	hsa-miR-4704-5p	CLIP-seq
MIRT1010320	hsa-miR-4710	CLIP-seq
MIRT1010321	hsa-miR-4712-5p	CLIP-seq
MIRT1010322	hsa-miR-4723-5p	CLIP-seq
MIRT1010323	hsa-miR-4728-5p	CLIP-seq
MIRT1010324	hsa-miR-4733-5p	CLIP-seq
MIRT1010325	hsa-miR-4748	CLIP-seq
MIRT1010326	hsa-miR-4753-5p	CLIP-seq
MIRT1010327	hsa-miR-4779	CLIP-seq
MIRT1010328	hsa-miR-4784	CLIP-seq
MIRT1010329	hsa-miR-4786-5p	CLIP-seq
MIRT1010330	hsa-miR-4789-3p	CLIP-seq
MIRT1010331	hsa-miR-4790-3p	CLIP-seq
MIRT1010332	hsa-miR-4797-5p	CLIP-seq
MIRT1010333	hsa-miR-486-5p	CLIP-seq
MIRT1010334	hsa-miR-488	CLIP-seq
MIRT1010335	hsa-miR-509-3-5p	CLIP-seq
MIRT1010336	hsa-miR-509-5p	CLIP-seq
MIRT1010337	hsa-miR-513b	CLIP-seq
MIRT1010338	hsa-miR-542-3p	CLIP-seq
MIRT1010339	hsa-miR-548aa	CLIP-seq
MIRT1010340	hsa-miR-548ac	CLIP-seq
MIRT1010341	hsa-miR-548d-3p	CLIP-seq
MIRT1010342	hsa-miR-548k	CLIP-seq
MIRT1010343	hsa-miR-548n	CLIP-seq
MIRT1010344	hsa-miR-548z	CLIP-seq
MIRT1010345	hsa-miR-583	CLIP-seq
MIRT1010346	hsa-miR-599	CLIP-seq
MIRT1010347	hsa-miR-603	CLIP-seq
MIRT1010348	hsa-miR-612	CLIP-seq
MIRT1010349	hsa-miR-625	CLIP-seq
MIRT1010350	hsa-miR-637	CLIP-seq
MIRT1010351	hsa-miR-659	CLIP-seq
MIRT1010352	hsa-miR-661	CLIP-seq
MIRT1010353	hsa-miR-665	CLIP-seq
MIRT1010354	hsa-miR-759	CLIP-seq
MIRT1010355	hsa-miR-769-5p	CLIP-seq
MIRT1010356	hsa-miR-770-5p	CLIP-seq
MIRT1010263	hsa-miR-1225-3p	CLIP-seq
MIRT1010265	hsa-miR-1233	CLIP-seq
MIRT1999214	hsa-miR-23a	CLIP-seq
MIRT1999215	hsa-miR-23b	CLIP-seq
MIRT1999216	hsa-miR-23c	CLIP-seq
MIRT1999217	hsa-miR-3658	CLIP-seq
MIRT1010291	hsa-miR-3689a-3p	CLIP-seq
MIRT1010292	hsa-miR-3689c	CLIP-seq
MIRT1999218	hsa-miR-4307	CLIP-seq
MIRT1999219	hsa-miR-4426	CLIP-seq
MIRT1999220	hsa-miR-4647	CLIP-seq
MIRT1999221	hsa-miR-4662b	CLIP-seq
MIRT1999222	hsa-miR-4717-3p	CLIP-seq
MIRT1010323	hsa-miR-4728-5p	CLIP-seq
MIRT1010324	hsa-miR-4733-5p	CLIP-seq
MIRT1010334	hsa-miR-488	CLIP-seq
MIRT1010263	hsa-miR-1225-3p	CLIP-seq
MIRT1010265	hsa-miR-1233	CLIP-seq
MIRT2232931	hsa-miR-3664-3p	CLIP-seq
MIRT2232932	hsa-miR-3681	CLIP-seq
MIRT2232933	hsa-miR-4433	CLIP-seq
MIRT1010304	hsa-miR-4459	CLIP-seq
MIRT2232934	hsa-miR-4768-3p	CLIP-seq
MIRT1010353	hsa-miR-665	CLIP-seq
MIRT1010263	hsa-miR-1225-3p	CLIP-seq
MIRT1010265	hsa-miR-1233	CLIP-seq
MIRT1010291	hsa-miR-3689a-3p	CLIP-seq
MIRT1010292	hsa-miR-3689c	CLIP-seq
MIRT1010304	hsa-miR-4459	CLIP-seq
MIRT1010323	hsa-miR-4728-5p	CLIP-seq
MIRT1010353	hsa-miR-665	CLIP-seq
MIRT1010263	hsa-miR-1225-3p	CLIP-seq
MIRT1010265	hsa-miR-1233	CLIP-seq
MIRT1010291	hsa-miR-3689a-3p	CLIP-seq
MIRT1010292	hsa-miR-3689c	CLIP-seq
MIRT1010304	hsa-miR-4459	CLIP-seq
MIRT1010323	hsa-miR-4728-5p	CLIP-seq
MIRT1010353	hsa-miR-665	CLIP-seq
MIRT1010263	hsa-miR-1225-3p	CLIP-seq
MIRT1010265	hsa-miR-1233	CLIP-seq
MIRT1010291	hsa-miR-3689a-3p	CLIP-seq
MIRT1010292	hsa-miR-3689c	CLIP-seq
MIRT1010304	hsa-miR-4459	CLIP-seq
MIRT1010323	hsa-miR-4728-5p	CLIP-seq
MIRT1010353	hsa-miR-665	CLIP-seq

Show/Hide all (3)

GO ID	Ontology	Definition	Evidence
GO:0003674	Function	Molecular_function	ND
GO:0005575	Component	Cellular_component	ND
GO:0008150	Process	Biological_process	ND

MIM	HGNC	e!Ensembl
300594	4098	ENSG00000205777

P0DTW1

Protein name

G antigen 1 (GAGE-1) (Antigen MZ2-F) (Cancer/testis antigen 4.1) (CT4.1)

Protein function

Antigen, recognized on melanoma by autologous cytolytic T-lymphocytes.

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Expressed in a variety of tumor tissues but not in normal tissues, except testis. {ECO:0000269|PubMed:7544395}.

Sequence

MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGE
DEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEGQSQC

Sequence length

117

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (27)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	14991579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	14991579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	14991579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	14991579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	7544395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10389981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	14991579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	14991579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10389981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	7544395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	14991579		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10397259, 7544395		★★★★★ ★☆☆☆☆ Found in Text Mining only
MELORHEOSTOSIS, ISOLATED	Melorheostosis	BEFREE	9050879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	17312182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	7544395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10389981, 10397259, 10928100, 9415308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nodular Goiter	Nodular Goiter	BEFREE	10493989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30103946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	12115308, 20423514	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	14991579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	10493989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20053773, 26885621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	BEFREE	12890744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	9415308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	16929165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29577858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	17312182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

GAGE1 (G antigen 1)