Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	254251
Gene name	Ligand dependent nuclear receptor corepressor like
Gene symbol	LCORL
Synonyms (NCBI Gene)	MLR1
Chromosome	4
Chromosome location	4p15.31
Summary	This gene encodes a transcription factor that appears to function in spermatogenesis. Polymorphisms in this gene are associated with measures of skeletal frame size and adult height. Alternative splicing results in multiple transcript variants. [provided

211

Show/Hide all (211)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020852	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT030939	hsa-miR-21-5p	Microarray	18591254
MIRT483930	hsa-miR-1273e	PAR-CLIP	22012620
MIRT483929	hsa-miR-3940-5p	PAR-CLIP	22012620
MIRT483928	hsa-miR-4507	PAR-CLIP	22012620
MIRT483926	hsa-miR-6839-3p	PAR-CLIP	22012620
MIRT483930	hsa-miR-1273e	PAR-CLIP	23446348
MIRT483929	hsa-miR-3940-5p	PAR-CLIP	23446348
MIRT483928	hsa-miR-4507	PAR-CLIP	23446348
MIRT483926	hsa-miR-6839-3p	PAR-CLIP	23446348
MIRT483930	hsa-miR-1273e	PAR-CLIP	23446348
MIRT483929	hsa-miR-3940-5p	PAR-CLIP	23446348
MIRT483928	hsa-miR-4507	PAR-CLIP	23446348
MIRT483926	hsa-miR-6839-3p	PAR-CLIP	23446348
MIRT483930	hsa-miR-1273e	PAR-CLIP	23592263
MIRT483929	hsa-miR-3940-5p	PAR-CLIP	23592263
MIRT483928	hsa-miR-4507	PAR-CLIP	23592263
MIRT483926	hsa-miR-6839-3p	PAR-CLIP	23592263
MIRT020852	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT020852	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT483930	hsa-miR-1273e	PAR-CLIP	22012620
MIRT483929	hsa-miR-3940-5p	PAR-CLIP	22012620
MIRT483928	hsa-miR-4507	PAR-CLIP	22012620
MIRT483926	hsa-miR-6839-3p	PAR-CLIP	22012620
MIRT483930	hsa-miR-1273e	PAR-CLIP	23446348
MIRT483929	hsa-miR-3940-5p	PAR-CLIP	23446348
MIRT483928	hsa-miR-4507	PAR-CLIP	23446348
MIRT483926	hsa-miR-6839-3p	PAR-CLIP	23446348
MIRT483930	hsa-miR-1273e	PAR-CLIP	23446348
MIRT483929	hsa-miR-3940-5p	PAR-CLIP	23446348
MIRT483928	hsa-miR-4507	PAR-CLIP	23446348
MIRT483926	hsa-miR-6839-3p	PAR-CLIP	23446348
MIRT483930	hsa-miR-1273e	PAR-CLIP	23592263
MIRT483929	hsa-miR-3940-5p	PAR-CLIP	23592263
MIRT483928	hsa-miR-4507	PAR-CLIP	23592263
MIRT483926	hsa-miR-6839-3p	PAR-CLIP	23592263
MIRT1106029	hsa-miR-105	CLIP-seq
MIRT1106030	hsa-miR-1183	CLIP-seq
MIRT1106031	hsa-miR-122	CLIP-seq
MIRT1106032	hsa-miR-1305	CLIP-seq
MIRT1106033	hsa-miR-18a	CLIP-seq
MIRT1106034	hsa-miR-18b	CLIP-seq
MIRT1106035	hsa-miR-200b	CLIP-seq
MIRT1106036	hsa-miR-200c	CLIP-seq
MIRT1106037	hsa-miR-204	CLIP-seq
MIRT1106038	hsa-miR-2052	CLIP-seq
MIRT1106039	hsa-miR-21	CLIP-seq
MIRT1106040	hsa-miR-211	CLIP-seq
MIRT1106041	hsa-miR-3150a-3p	CLIP-seq
MIRT1106042	hsa-miR-3154	CLIP-seq
MIRT1106043	hsa-miR-3163	CLIP-seq
MIRT1106044	hsa-miR-3175	CLIP-seq
MIRT1106045	hsa-miR-3179	CLIP-seq
MIRT1106046	hsa-miR-323b-5p	CLIP-seq
MIRT1106047	hsa-miR-329	CLIP-seq
MIRT1106048	hsa-miR-34b	CLIP-seq
MIRT1106049	hsa-miR-3607-3p	CLIP-seq
MIRT1106050	hsa-miR-362-3p	CLIP-seq
MIRT1106051	hsa-miR-3646	CLIP-seq
MIRT1106052	hsa-miR-3671	CLIP-seq
MIRT1106053	hsa-miR-3686	CLIP-seq
MIRT1106054	hsa-miR-369-3p	CLIP-seq
MIRT1106055	hsa-miR-3714	CLIP-seq
MIRT1106056	hsa-miR-374a	CLIP-seq
MIRT1106057	hsa-miR-374b	CLIP-seq
MIRT1106058	hsa-miR-3922-5p	CLIP-seq
MIRT1106059	hsa-miR-3941	CLIP-seq
MIRT1106060	hsa-miR-4255	CLIP-seq
MIRT1106061	hsa-miR-4282	CLIP-seq
MIRT1106062	hsa-miR-429	CLIP-seq
MIRT1106063	hsa-miR-4307	CLIP-seq
MIRT1106064	hsa-miR-4325	CLIP-seq
MIRT1106065	hsa-miR-4434	CLIP-seq
MIRT1106066	hsa-miR-4440	CLIP-seq
MIRT1106067	hsa-miR-4446-5p	CLIP-seq
MIRT1106068	hsa-miR-4516	CLIP-seq
MIRT1106069	hsa-miR-4667-5p	CLIP-seq
MIRT1106070	hsa-miR-4691-3p	CLIP-seq
MIRT1106071	hsa-miR-4698	CLIP-seq
MIRT1106072	hsa-miR-4700-5p	CLIP-seq
MIRT1106073	hsa-miR-4719	CLIP-seq
MIRT1106074	hsa-miR-4735-3p	CLIP-seq
MIRT1106075	hsa-miR-4755-5p	CLIP-seq
MIRT1106076	hsa-miR-4761-5p	CLIP-seq
MIRT1106077	hsa-miR-4764-3p	CLIP-seq
MIRT1106078	hsa-miR-500a	CLIP-seq
MIRT1106079	hsa-miR-514	CLIP-seq
MIRT1106080	hsa-miR-514b-3p	CLIP-seq
MIRT1106081	hsa-miR-548a-3p	CLIP-seq
MIRT1106082	hsa-miR-548e	CLIP-seq
MIRT1106083	hsa-miR-548f	CLIP-seq
MIRT1106084	hsa-miR-556-3p	CLIP-seq
MIRT1106085	hsa-miR-574-5p	CLIP-seq
MIRT1106086	hsa-miR-590-5p	CLIP-seq
MIRT1106087	hsa-miR-592	CLIP-seq
MIRT1106088	hsa-miR-597	CLIP-seq
MIRT1106089	hsa-miR-603	CLIP-seq
MIRT1106090	hsa-miR-606	CLIP-seq
MIRT1106091	hsa-miR-607	CLIP-seq
MIRT1106092	hsa-miR-623	CLIP-seq
MIRT1106093	hsa-miR-624	CLIP-seq
MIRT1106094	hsa-miR-633	CLIP-seq
MIRT1106095	hsa-miR-656	CLIP-seq
MIRT1106096	hsa-miR-939	CLIP-seq
MIRT2029282	hsa-miR-1260	CLIP-seq
MIRT2029283	hsa-miR-1260b	CLIP-seq
MIRT2029284	hsa-miR-133a	CLIP-seq
MIRT2029285	hsa-miR-133b	CLIP-seq
MIRT2029286	hsa-miR-1343	CLIP-seq
MIRT2029287	hsa-miR-188-3p	CLIP-seq
MIRT2029288	hsa-miR-3156-3p	CLIP-seq
MIRT2029289	hsa-miR-3165	CLIP-seq
MIRT1106045	hsa-miR-3179	CLIP-seq
MIRT1106049	hsa-miR-3607-3p	CLIP-seq
MIRT2029290	hsa-miR-3662	CLIP-seq
MIRT2029291	hsa-miR-4275	CLIP-seq
MIRT1106067	hsa-miR-4446-5p	CLIP-seq
MIRT2029292	hsa-miR-4456	CLIP-seq
MIRT2029293	hsa-miR-4636	CLIP-seq
MIRT1106073	hsa-miR-4719	CLIP-seq
MIRT2029294	hsa-miR-4760-3p	CLIP-seq
MIRT2029295	hsa-miR-491-3p	CLIP-seq
MIRT1106081	hsa-miR-548a-3p	CLIP-seq
MIRT2029296	hsa-miR-548c-3p	CLIP-seq
MIRT1106082	hsa-miR-548e	CLIP-seq
MIRT1106083	hsa-miR-548f	CLIP-seq
MIRT1106089	hsa-miR-603	CLIP-seq
MIRT2260216	hsa-miR-101	CLIP-seq
MIRT2260217	hsa-miR-1208	CLIP-seq
MIRT2260218	hsa-miR-1228	CLIP-seq
MIRT2260219	hsa-miR-1237	CLIP-seq
MIRT2260220	hsa-miR-1248	CLIP-seq
MIRT2260221	hsa-miR-1264	CLIP-seq
MIRT1106032	hsa-miR-1305	CLIP-seq
MIRT2260222	hsa-miR-144	CLIP-seq
MIRT2260223	hsa-miR-15a	CLIP-seq
MIRT2260224	hsa-miR-15b	CLIP-seq
MIRT2260225	hsa-miR-16	CLIP-seq
MIRT2260226	hsa-miR-195	CLIP-seq
MIRT2260227	hsa-miR-203	CLIP-seq
MIRT2260228	hsa-miR-205	CLIP-seq
MIRT1106038	hsa-miR-2052	CLIP-seq
MIRT2260229	hsa-miR-296-3p	CLIP-seq
MIRT2260230	hsa-miR-299-5p	CLIP-seq
MIRT2260231	hsa-miR-300	CLIP-seq
MIRT1106041	hsa-miR-3150a-3p	CLIP-seq
MIRT1106042	hsa-miR-3154	CLIP-seq
MIRT2260232	hsa-miR-3160-5p	CLIP-seq
MIRT1106043	hsa-miR-3163	CLIP-seq
MIRT1106044	hsa-miR-3175	CLIP-seq
MIRT1106045	hsa-miR-3179	CLIP-seq
MIRT1106047	hsa-miR-329	CLIP-seq
MIRT1106048	hsa-miR-34b	CLIP-seq
MIRT1106050	hsa-miR-362-3p	CLIP-seq
MIRT2260233	hsa-miR-3647-3p	CLIP-seq
MIRT2029290	hsa-miR-3662	CLIP-seq
MIRT1106052	hsa-miR-3671	CLIP-seq
MIRT1106055	hsa-miR-3714	CLIP-seq
MIRT2260234	hsa-miR-381	CLIP-seq
MIRT1106058	hsa-miR-3922-5p	CLIP-seq
MIRT1106059	hsa-miR-3941	CLIP-seq
MIRT2260235	hsa-miR-424	CLIP-seq
MIRT1106061	hsa-miR-4282	CLIP-seq
MIRT1106063	hsa-miR-4307	CLIP-seq
MIRT2260236	hsa-miR-4328	CLIP-seq
MIRT1106065	hsa-miR-4434	CLIP-seq
MIRT1106068	hsa-miR-4516	CLIP-seq
MIRT2260237	hsa-miR-452	CLIP-seq
MIRT2260238	hsa-miR-4528	CLIP-seq
MIRT2260239	hsa-miR-4652-3p	CLIP-seq
MIRT2260240	hsa-miR-4666-3p	CLIP-seq
MIRT1106069	hsa-miR-4667-5p	CLIP-seq
MIRT2260241	hsa-miR-4676-3p	CLIP-seq
MIRT1106070	hsa-miR-4691-3p	CLIP-seq
MIRT1106071	hsa-miR-4698	CLIP-seq
MIRT1106072	hsa-miR-4700-5p	CLIP-seq
MIRT1106073	hsa-miR-4719	CLIP-seq
MIRT2260242	hsa-miR-4731-3p	CLIP-seq
MIRT2260243	hsa-miR-4753-3p	CLIP-seq
MIRT2029294	hsa-miR-4760-3p	CLIP-seq
MIRT2260244	hsa-miR-4768-5p	CLIP-seq
MIRT2260245	hsa-miR-4797-5p	CLIP-seq
MIRT2260246	hsa-miR-4801	CLIP-seq
MIRT2260247	hsa-miR-497	CLIP-seq
MIRT2260248	hsa-miR-5096	CLIP-seq
MIRT2260249	hsa-miR-522	CLIP-seq
MIRT2260250	hsa-miR-543	CLIP-seq
MIRT2260251	hsa-miR-548n	CLIP-seq
MIRT2260252	hsa-miR-548t	CLIP-seq
MIRT2260253	hsa-miR-561	CLIP-seq
MIRT2260254	hsa-miR-582-5p	CLIP-seq
MIRT1106089	hsa-miR-603	CLIP-seq
MIRT2260255	hsa-miR-616	CLIP-seq
MIRT1106094	hsa-miR-633	CLIP-seq
MIRT2260256	hsa-miR-889	CLIP-seq
MIRT1106096	hsa-miR-939	CLIP-seq
MIRT2260216	hsa-miR-101	CLIP-seq
MIRT2260222	hsa-miR-144	CLIP-seq
MIRT1106073	hsa-miR-4719	CLIP-seq
MIRT2260242	hsa-miR-4731-3p	CLIP-seq
MIRT2260246	hsa-miR-4801	CLIP-seq
MIRT2260254	hsa-miR-582-5p	CLIP-seq
MIRT1106089	hsa-miR-603	CLIP-seq
MIRT2438332	hsa-miR-323-3p	CLIP-seq
MIRT2438333	hsa-miR-411	CLIP-seq
MIRT2452897	hsa-miR-1323	CLIP-seq
MIRT1106051	hsa-miR-3646	CLIP-seq
MIRT2452898	hsa-miR-548o	CLIP-seq
MIRT2452899	hsa-miR-944	CLIP-seq
MIRT2438332	hsa-miR-323-3p	CLIP-seq
MIRT2438333	hsa-miR-411	CLIP-seq

Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	21900206, 24981860, 25416956, 28514442, 31041561, 32296183, 33961781, 35016035
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:1990226	Function	Histone methyltransferase binding	IEA
GO:1990226	Function	Histone methyltransferase binding	IPI	29628311

MIM	HGNC	e!Ensembl
611799	30776	ENSG00000178177

Q8N3X6

Protein name

Ligand-dependent nuclear receptor corepressor-like protein (LCoR-like protein)

Protein function

May act as transcription activator that binds DNA elements with the sequence 5'-CCCTATCGATCGATCTCTACCT-3'. May play a role in spermatogenesis (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05225	HTH_psq	277 → 314	helix-turn-helix, Psq domain	Domain
PF05225	HTH_psq	526 → 571	helix-turn-helix, Psq domain	Domain

Sequence

MDKGRERMAAAAAAAAAAAAAAQCRSPRCAAERRGFRRELDSWRHRLMHCVGFESILEGL
YGPRLRRDLSLFEDCEPEELTDWSMDEKCSFCNLQREAVSDCIPSLDSSQSTPTEELSSQ
GQSNTDKIECQAENYLNALFRKKDLPQNCDPNIPLVAQELMKKMIRQFAIEYISKSGKTQ
ENRNGSIGPSIVCKSIQMNQAENSLQEEQEGPLDLTVNRMQEQNTQQGDGVLDLSTKKTS
IKSEESSICDPSSENSVAGRLHRNREDYVERSAEFADGLLSKALKDIQSGALDINKAGIL
YGIPQKTLLLHLEALPAGKPASFKNKTRDFHDSYSYKDSKETCAVLQKVALWARAQAERT
EKSKLNLLETSEIKFPTASTYLHQLTLQKMVTQFKEKNESLQYETSNPTVQLKIPQLRVS
SVSKSQPDGSGLLDVMYQVSKTSSVLEGSALQKLKNILPKQNKIECSGPVTHSSVDSYFL
HGDLSPLCLNSKNGTVDGTSENTEDGLDRKDSKQPRKKRGRYRQYDHEIMEEAIAMVMSG
KMSVSKAQGIYGVPHSTLEYKVKERSGTLKTPPKKKLRLPDTGLYNMTDSGTGSCKNSSK
PV

Sequence length

602

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (26)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPITUITARISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	29860282	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	29924316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	37328865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	27986804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	28744006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	37328865	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	BEFREE	29924316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	GWASCAT_DG	29924316		★★★★★ ★☆☆☆☆ Found in Text Mining only

LCORL (ligand dependent nuclear receptor corepressor like)