TTLL10 (tubulin tyrosine ligase like 10)

Gene

• Entrez ID: 254173
• Gene name: Tubulin tyrosine ligase like 10
• Gene symbol: TTLL10
• Synonyms (NCBI Gene): TTLL5
• Chromosome: 1
• Chromosome location: 1p36.33

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1462320	hsa-miR-1202	CLIP-seq
MIRT1462321	hsa-miR-139-3p	CLIP-seq
MIRT1462322	hsa-miR-3121-5p	CLIP-seq
MIRT1462323	hsa-miR-3158-3p	CLIP-seq
MIRT1462324	hsa-miR-3194-5p	CLIP-seq
MIRT1462325	hsa-miR-3972	CLIP-seq
MIRT1462326	hsa-miR-4446-3p	CLIP-seq
MIRT1462327	hsa-miR-4468	CLIP-seq
MIRT1462328	hsa-miR-4512	CLIP-seq
MIRT2139041	hsa-miR-2467-5p	CLIP-seq
MIRT2139042	hsa-miR-2861	CLIP-seq
MIRT2139043	hsa-miR-329	CLIP-seq
MIRT2139044	hsa-miR-339-3p	CLIP-seq
MIRT2139045	hsa-miR-3612	CLIP-seq
MIRT2139046	hsa-miR-362-3p	CLIP-seq
MIRT2139047	hsa-miR-3921	CLIP-seq
MIRT2139048	hsa-miR-4268	CLIP-seq
MIRT2139049	hsa-miR-4303	CLIP-seq
MIRT2139050	hsa-miR-4443	CLIP-seq
MIRT2139051	hsa-miR-4653-5p	CLIP-seq
MIRT2139052	hsa-miR-582-3p	CLIP-seq
MIRT2139053	hsa-miR-650	CLIP-seq
MIRT2359762	hsa-miR-1197	CLIP-seq
MIRT2139043	hsa-miR-329	CLIP-seq
MIRT2139046	hsa-miR-362-3p	CLIP-seq
MIRT2359763	hsa-miR-4436a	CLIP-seq
MIRT2359764	hsa-miR-665	CLIP-seq
MIRT1462323	hsa-miR-3158-3p	CLIP-seq
MIRT2396464	hsa-miR-3616-5p	CLIP-seq
MIRT2396465	hsa-miR-3647-5p	CLIP-seq
MIRT1462326	hsa-miR-4446-3p	CLIP-seq
MIRT2396466	hsa-miR-4675	CLIP-seq
MIRT2396467	hsa-miR-4687-3p	CLIP-seq
MIRT2396468	hsa-miR-4741	CLIP-seq
MIRT2396469	hsa-miR-573	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0005515	Function	Protein binding	IPI	18331838, 25416956, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0018094	Process	Protein polyglycylation	IDA	19524510
GO:0070735	Function	Protein-glycine ligase activity	IDA	19524510
GO:0070735	Function	Protein-glycine ligase activity	TAS

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q6ZVT0
• Protein name: Inactive polyglycylase TTLL10 (Tubulin--tyrosine ligase-like protein 10)
• Protein function: Inactive polyglycylase.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03133	TTL	211 → 548	Tubulin-tyrosine ligase family	Family

• Sequence:

  MDHSCTRFIHRRGPPTRTRAGFKRGKRPRIQQRPRARVSGTIPASRLHPAPASQPGPCPA
  PGHCPVGPAHERPMGSSQEEGLRCQPSQPDHDADGHCGPDLEGAERASATPGPPGLLNSH
  RPADSDDTNAAGPSAALLEGLLLGGGKPSPHSTRPGPFFYIGGSNGATIISSYCKSKGWQ
  RIHDSRRDDYTLKWCEVKSRDSYGSFREGEQLLYQLPNNKLLTTKIGLLSTLRGRARAMS
  KASKVPGGVQARLEKDAAAPALEDLPWTSPGYLRPQRVLRMEEFFPETYRLDLKHEREAF
  FTLFDETQIWICKPTASNQGKGIFLLRNQEEVAALQAKTRSMEDDPIHHKTPFRGPQARV
  VQRYIQNPLLVDGRKFDVRSYLLIACTTPYMIFFGHGYARLTLSLYDPHSSDLGGHLTNQ
  FMQKKSPLYMLLKEHTVWSMEHLNRYISDTFWKARGLAKDWVFTTLKKRMQQIMAHCFLA
  AKPKLDCKLGYFDLIGCDFLIDDNFKVWLLEMNSNPALHTNCEVLKEVIPGVVIETLDLV
  LETFRKSLRGQKMLPLLSQRRFVLLHNGEADPRPHLGGSCSLRRWPPLPTRQAKSSGPPM
  PHAPDQPGARRPAPPPLVPQRPRPPGPDLDSAHDGEPQAPGTEQSGTGNRHPAQEPSPGT
  AKEEREEPENARP

• Sequence length: 673

Pathways

Reactome:

Carboxyterminal post-translational modifications of tubulin

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anxiety	Anxiety Disorder	BEFREE	29683703		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29683703		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	20374646		★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	GWASCAT_DG	30833571		★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathy	Pubtator	38264610	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Cone Dystrophy	Cone Dystrophy	BEFREE	28356705		★☆☆☆☆ Found in Text Mining only
Cone Dystrophy	Cone dystrophy	Pubtator	28356705, 34203883, 35365235	Associate	★☆☆☆☆ Found in Text Mining only
Cone Dystrophy 3	Cone dystrophy	Pubtator	38264610	Associate	★☆☆☆☆ Found in Text Mining only
Cone rod dystrophy	Cone-rod dystrophy	Orphanet			★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophies	Cone-rod dystrophy	BEFREE	28173158		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophies	Cone-rod dystrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
CONE-ROD DYSTROPHY 19	Cone-rod dystrophy	UNIPROT_DG	24791901		★☆☆☆☆ Found in Text Mining only
CONE-ROD DYSTROPHY 19	Cone-rod dystrophy	GENOMICS_ENGLAND_DG	28173158		★☆☆☆☆ Found in Text Mining only
CONE-ROD DYSTROPHY 19	Cone-rod dystrophy	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
CONE-ROD DYSTROPHY 19	Cone-rod dystrophy	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	ORPHANET_DG	24791901		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	30346536		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	38264610	Associate	★☆☆☆☆ Found in Text Mining only
Encephaloclastic Proliferative Vasculopathy	Proliferative vasculopathy and hydranencephaly-hydrocephaly syndrome	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	23028188	Associate	★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	20374646		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20374646, 20924965		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	30909976		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	20924965		★☆☆☆☆ Found in Text Mining only
Night blindness congenital stationary	Night blindness, congenital stationary	Pubtator	28356705	Associate	★☆☆☆☆ Found in Text Mining only
Nyctalopia	Nyctalopia	HPO_DG			★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	20374646		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20374646	Associate	★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	28173158		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	35365235	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Dystrophies	Retinal Dystrophy	BEFREE	24791901		★☆☆☆☆ Found in Text Mining only
Retinal Dystrophies	Retinal Dystrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	32065787	Associate	★☆☆☆☆ Found in Text Mining only