Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2537
Gene name	Interferon alpha inducible protein 6
Gene symbol	IFI6
Synonyms (NCBI Gene)	6-16FAM14CG1P3IFI-6-16IFI616
Chromosome	1
Chromosome location	1p35.3
Summary	This gene was first identified as one of the many genes induced by interferon. The encoded protein may play a critical role in the regulation of apoptosis. A minisatellite that consists of 26 repeats of a 12 nucleotide repeating element resembling the mam

242

Show/Hide all (242)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019676	hsa-miR-375	Microarray	20215506
MIRT054332	hsa-miR-1225-3p	MicroarrayqRT-PCR	23593351
MIRT1060280	hsa-miR-1285	CLIP-seq
MIRT1060281	hsa-miR-1299	CLIP-seq
MIRT1060282	hsa-miR-1469	CLIP-seq
MIRT1060283	hsa-miR-2054	CLIP-seq
MIRT1060284	hsa-miR-3187-5p	CLIP-seq
MIRT1060285	hsa-miR-3672	CLIP-seq
MIRT1060286	hsa-miR-3689a-3p	CLIP-seq
MIRT1060287	hsa-miR-3689c	CLIP-seq
MIRT1060288	hsa-miR-378g	CLIP-seq
MIRT1060289	hsa-miR-3945	CLIP-seq
MIRT1060290	hsa-miR-4253	CLIP-seq
MIRT1060291	hsa-miR-4314	CLIP-seq
MIRT1060292	hsa-miR-4320	CLIP-seq
MIRT1060293	hsa-miR-4459	CLIP-seq
MIRT1060294	hsa-miR-4486	CLIP-seq
MIRT1060295	hsa-miR-4693-3p	CLIP-seq
MIRT1060296	hsa-miR-4728-5p	CLIP-seq
MIRT1060297	hsa-miR-4765	CLIP-seq
MIRT1060298	hsa-miR-4782-5p	CLIP-seq
MIRT1060299	hsa-miR-500a	CLIP-seq
MIRT1060300	hsa-miR-516b	CLIP-seq
MIRT1060301	hsa-miR-612	CLIP-seq
MIRT1060302	hsa-miR-890	CLIP-seq
MIRT1060303	hsa-miR-1262	CLIP-seq
MIRT1060291	hsa-miR-4314	CLIP-seq
MIRT1060304	hsa-miR-4652-3p	CLIP-seq
MIRT1060305	hsa-miR-4670-3p	CLIP-seq
MIRT1060306	hsa-miR-4701-3p	CLIP-seq
MIRT1060307	hsa-miR-4778-5p	CLIP-seq
MIRT1556557	hsa-miR-1257	CLIP-seq
MIRT1060280	hsa-miR-1285	CLIP-seq
MIRT1060281	hsa-miR-1299	CLIP-seq
MIRT1556558	hsa-miR-1304	CLIP-seq
MIRT1060282	hsa-miR-1469	CLIP-seq
MIRT1060283	hsa-miR-2054	CLIP-seq
MIRT1556559	hsa-miR-2110	CLIP-seq
MIRT1556560	hsa-miR-2467-5p	CLIP-seq
MIRT1556561	hsa-miR-3147	CLIP-seq
MIRT1556562	hsa-miR-3150a-3p	CLIP-seq
MIRT1556563	hsa-miR-3175	CLIP-seq
MIRT1060284	hsa-miR-3187-5p	CLIP-seq
MIRT1556564	hsa-miR-3188	CLIP-seq
MIRT1556565	hsa-miR-3612	CLIP-seq
MIRT1556566	hsa-miR-3614-5p	CLIP-seq
MIRT1060288	hsa-miR-378g	CLIP-seq
MIRT1060289	hsa-miR-3945	CLIP-seq
MIRT1556567	hsa-miR-3975	CLIP-seq
MIRT1060290	hsa-miR-4253	CLIP-seq
MIRT1060291	hsa-miR-4314	CLIP-seq
MIRT1060292	hsa-miR-4320	CLIP-seq
MIRT1556568	hsa-miR-4425	CLIP-seq
MIRT1556569	hsa-miR-4443	CLIP-seq
MIRT1060293	hsa-miR-4459	CLIP-seq
MIRT1060294	hsa-miR-4486	CLIP-seq
MIRT1556570	hsa-miR-4677-3p	CLIP-seq
MIRT1556571	hsa-miR-4679	CLIP-seq
MIRT1060295	hsa-miR-4693-3p	CLIP-seq
MIRT1060297	hsa-miR-4765	CLIP-seq
MIRT1060298	hsa-miR-4782-5p	CLIP-seq
MIRT1556572	hsa-miR-485-5p	CLIP-seq
MIRT1060300	hsa-miR-516b	CLIP-seq
MIRT1556573	hsa-miR-571	CLIP-seq
MIRT1060301	hsa-miR-612	CLIP-seq
MIRT1556574	hsa-miR-650	CLIP-seq
MIRT1556575	hsa-miR-939	CLIP-seq
MIRT2014102	hsa-miR-1251	CLIP-seq
MIRT1556557	hsa-miR-1257	CLIP-seq
MIRT1556559	hsa-miR-2110	CLIP-seq
MIRT2014103	hsa-miR-23a	CLIP-seq
MIRT2014104	hsa-miR-23b	CLIP-seq
MIRT2014105	hsa-miR-23c	CLIP-seq
MIRT1556561	hsa-miR-3147	CLIP-seq
MIRT1556562	hsa-miR-3150a-3p	CLIP-seq
MIRT1556563	hsa-miR-3175	CLIP-seq
MIRT2014106	hsa-miR-4252	CLIP-seq
MIRT2014107	hsa-miR-4293	CLIP-seq
MIRT1556568	hsa-miR-4425	CLIP-seq
MIRT1060304	hsa-miR-4652-3p	CLIP-seq
MIRT1060295	hsa-miR-4693-3p	CLIP-seq
MIRT1060297	hsa-miR-4765	CLIP-seq
MIRT1060307	hsa-miR-4778-5p	CLIP-seq
MIRT2014108	hsa-miR-4793-3p	CLIP-seq
MIRT2014109	hsa-miR-5096	CLIP-seq
MIRT2014110	hsa-miR-596	CLIP-seq
MIRT1556575	hsa-miR-939	CLIP-seq
MIRT2014103	hsa-miR-23a	CLIP-seq
MIRT2014104	hsa-miR-23b	CLIP-seq
MIRT2014105	hsa-miR-23c	CLIP-seq
MIRT1060304	hsa-miR-4652-3p	CLIP-seq
MIRT1060307	hsa-miR-4778-5p	CLIP-seq
MIRT2014109	hsa-miR-5096	CLIP-seq
MIRT2014102	hsa-miR-1251	CLIP-seq
MIRT2437695	hsa-miR-1254	CLIP-seq
MIRT1556557	hsa-miR-1257	CLIP-seq
MIRT1060280	hsa-miR-1285	CLIP-seq
MIRT1060281	hsa-miR-1299	CLIP-seq
MIRT1556558	hsa-miR-1304	CLIP-seq
MIRT1060282	hsa-miR-1469	CLIP-seq
MIRT1556560	hsa-miR-2467-5p	CLIP-seq
MIRT2437696	hsa-miR-3116	CLIP-seq
MIRT1060284	hsa-miR-3187-5p	CLIP-seq
MIRT1556564	hsa-miR-3188	CLIP-seq
MIRT1556565	hsa-miR-3612	CLIP-seq
MIRT1556566	hsa-miR-3614-5p	CLIP-seq
MIRT2437697	hsa-miR-3690	CLIP-seq
MIRT1060288	hsa-miR-378g	CLIP-seq
MIRT1060289	hsa-miR-3945	CLIP-seq
MIRT1556567	hsa-miR-3975	CLIP-seq
MIRT2014106	hsa-miR-4252	CLIP-seq
MIRT1060290	hsa-miR-4253	CLIP-seq
MIRT2014107	hsa-miR-4293	CLIP-seq
MIRT1060291	hsa-miR-4314	CLIP-seq
MIRT1060292	hsa-miR-4320	CLIP-seq
MIRT1556569	hsa-miR-4443	CLIP-seq
MIRT1060293	hsa-miR-4459	CLIP-seq
MIRT1060294	hsa-miR-4486	CLIP-seq
MIRT2437698	hsa-miR-4638-3p	CLIP-seq
MIRT1556570	hsa-miR-4677-3p	CLIP-seq
MIRT1556571	hsa-miR-4679	CLIP-seq
MIRT1060298	hsa-miR-4782-5p	CLIP-seq
MIRT2014108	hsa-miR-4793-3p	CLIP-seq
MIRT1556572	hsa-miR-485-5p	CLIP-seq
MIRT1060300	hsa-miR-516b	CLIP-seq
MIRT1556573	hsa-miR-571	CLIP-seq
MIRT2014110	hsa-miR-596	CLIP-seq
MIRT1060301	hsa-miR-612	CLIP-seq
MIRT1556574	hsa-miR-650	CLIP-seq
MIRT2014102	hsa-miR-1251	CLIP-seq
MIRT2549544	hsa-miR-1252	CLIP-seq
MIRT2437695	hsa-miR-1254	CLIP-seq
MIRT1556557	hsa-miR-1257	CLIP-seq
MIRT2549545	hsa-miR-1273d	CLIP-seq
MIRT1060280	hsa-miR-1285	CLIP-seq
MIRT1060281	hsa-miR-1299	CLIP-seq
MIRT1556558	hsa-miR-1304	CLIP-seq
MIRT1060282	hsa-miR-1469	CLIP-seq
MIRT2549546	hsa-miR-146a	CLIP-seq
MIRT2549547	hsa-miR-146b-5p	CLIP-seq
MIRT1060283	hsa-miR-2054	CLIP-seq
MIRT1556560	hsa-miR-2467-5p	CLIP-seq
MIRT2437696	hsa-miR-3116	CLIP-seq
MIRT2549548	hsa-miR-3174	CLIP-seq
MIRT2549549	hsa-miR-3185	CLIP-seq
MIRT1060284	hsa-miR-3187-5p	CLIP-seq
MIRT1556564	hsa-miR-3188	CLIP-seq
MIRT2549550	hsa-miR-3192	CLIP-seq
MIRT2549551	hsa-miR-338-5p	CLIP-seq
MIRT1556565	hsa-miR-3612	CLIP-seq
MIRT2549552	hsa-miR-3613-3p	CLIP-seq
MIRT1556566	hsa-miR-3614-5p	CLIP-seq
MIRT1060285	hsa-miR-3672	CLIP-seq
MIRT1060286	hsa-miR-3689a-3p	CLIP-seq
MIRT1060287	hsa-miR-3689c	CLIP-seq
MIRT2437697	hsa-miR-3690	CLIP-seq
MIRT2549553	hsa-miR-371-5p	CLIP-seq
MIRT2549554	hsa-miR-371b-5p	CLIP-seq
MIRT1060288	hsa-miR-378g	CLIP-seq
MIRT1060289	hsa-miR-3945	CLIP-seq
MIRT1556567	hsa-miR-3975	CLIP-seq
MIRT2014106	hsa-miR-4252	CLIP-seq
MIRT1060290	hsa-miR-4253	CLIP-seq
MIRT2014107	hsa-miR-4293	CLIP-seq
MIRT2549555	hsa-miR-4300	CLIP-seq
MIRT1060291	hsa-miR-4314	CLIP-seq
MIRT1060292	hsa-miR-4320	CLIP-seq
MIRT1556569	hsa-miR-4443	CLIP-seq
MIRT1060293	hsa-miR-4459	CLIP-seq
MIRT1060294	hsa-miR-4486	CLIP-seq
MIRT2437698	hsa-miR-4638-3p	CLIP-seq
MIRT2549556	hsa-miR-4646-5p	CLIP-seq
MIRT1556570	hsa-miR-4677-3p	CLIP-seq
MIRT1556571	hsa-miR-4679	CLIP-seq
MIRT1060296	hsa-miR-4728-5p	CLIP-seq
MIRT1060298	hsa-miR-4782-5p	CLIP-seq
MIRT2014108	hsa-miR-4793-3p	CLIP-seq
MIRT1556572	hsa-miR-485-5p	CLIP-seq
MIRT1060299	hsa-miR-500a	CLIP-seq
MIRT1060300	hsa-miR-516b	CLIP-seq
MIRT2549557	hsa-miR-558	CLIP-seq
MIRT1556573	hsa-miR-571	CLIP-seq
MIRT2549558	hsa-miR-589	CLIP-seq
MIRT2014110	hsa-miR-596	CLIP-seq
MIRT1060301	hsa-miR-612	CLIP-seq
MIRT1556574	hsa-miR-650	CLIP-seq
MIRT1060302	hsa-miR-890	CLIP-seq
MIRT2549559	hsa-miR-920	CLIP-seq
MIRT2549560	hsa-miR-921	CLIP-seq
MIRT2014102	hsa-miR-1251	CLIP-seq
MIRT2437695	hsa-miR-1254	CLIP-seq
MIRT1556557	hsa-miR-1257	CLIP-seq
MIRT2549545	hsa-miR-1273d	CLIP-seq
MIRT1060280	hsa-miR-1285	CLIP-seq
MIRT1060281	hsa-miR-1299	CLIP-seq
MIRT1556558	hsa-miR-1304	CLIP-seq
MIRT1060282	hsa-miR-1469	CLIP-seq
MIRT2549546	hsa-miR-146a	CLIP-seq
MIRT2549547	hsa-miR-146b-5p	CLIP-seq
MIRT1060283	hsa-miR-2054	CLIP-seq
MIRT1556560	hsa-miR-2467-5p	CLIP-seq
MIRT2437696	hsa-miR-3116	CLIP-seq
MIRT2549548	hsa-miR-3174	CLIP-seq
MIRT1060284	hsa-miR-3187-5p	CLIP-seq
MIRT1556564	hsa-miR-3188	CLIP-seq
MIRT2549551	hsa-miR-338-5p	CLIP-seq
MIRT1556565	hsa-miR-3612	CLIP-seq
MIRT2549552	hsa-miR-3613-3p	CLIP-seq
MIRT1556566	hsa-miR-3614-5p	CLIP-seq
MIRT1060285	hsa-miR-3672	CLIP-seq
MIRT1060286	hsa-miR-3689a-3p	CLIP-seq
MIRT1060287	hsa-miR-3689c	CLIP-seq
MIRT2437697	hsa-miR-3690	CLIP-seq
MIRT2549553	hsa-miR-371-5p	CLIP-seq
MIRT2549554	hsa-miR-371b-5p	CLIP-seq
MIRT1060288	hsa-miR-378g	CLIP-seq
MIRT1060289	hsa-miR-3945	CLIP-seq
MIRT1556567	hsa-miR-3975	CLIP-seq
MIRT2014106	hsa-miR-4252	CLIP-seq
MIRT1060290	hsa-miR-4253	CLIP-seq
MIRT2014107	hsa-miR-4293	CLIP-seq
MIRT1060291	hsa-miR-4314	CLIP-seq
MIRT1060292	hsa-miR-4320	CLIP-seq
MIRT1556569	hsa-miR-4443	CLIP-seq
MIRT1060293	hsa-miR-4459	CLIP-seq
MIRT1060294	hsa-miR-4486	CLIP-seq
MIRT2437698	hsa-miR-4638-3p	CLIP-seq
MIRT1556570	hsa-miR-4677-3p	CLIP-seq
MIRT1556571	hsa-miR-4679	CLIP-seq
MIRT1060296	hsa-miR-4728-5p	CLIP-seq
MIRT1060298	hsa-miR-4782-5p	CLIP-seq
MIRT2014108	hsa-miR-4793-3p	CLIP-seq
MIRT1556572	hsa-miR-485-5p	CLIP-seq
MIRT1060299	hsa-miR-500a	CLIP-seq
MIRT1060300	hsa-miR-516b	CLIP-seq
MIRT1556573	hsa-miR-571	CLIP-seq
MIRT2549558	hsa-miR-589	CLIP-seq
MIRT2014110	hsa-miR-596	CLIP-seq
MIRT1060301	hsa-miR-612	CLIP-seq
MIRT1556574	hsa-miR-650	CLIP-seq
MIRT1060302	hsa-miR-890	CLIP-seq
MIRT2549560	hsa-miR-921	CLIP-seq

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	15685448
GO:0005739	Component	Mitochondrion	IDA	15685448, 25757571
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005743	Component	Mitochondrial inner membrane	IDA	29899394
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IMP	27673746
GO:0006955	Process	Immune response	TAS	3017706
GO:0016020	Component	Membrane	IEA
GO:0031966	Component	Mitochondrial membrane	IBA
GO:0031966	Component	Mitochondrial membrane	IDA	17823654
GO:0042058	Process	Regulation of epidermal growth factor receptor signaling pathway	IMP	25757571
GO:0043066	Process	Negative regulation of apoptotic process	IMP	17823654
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	IMP	25757571
GO:0051607	Process	Defense response to virus	IEA
GO:0051607	Process	Defense response to virus	IMP	25757571
GO:0051902	Process	Negative regulation of mitochondrial depolarization	IMP	15685448
GO:0060090	Function	Molecular adaptor activity	IBA
GO:0072593	Process	Reactive oxygen species metabolic process	IMP	29899394
GO:0090201	Process	Negative regulation of release of cytochrome c from mitochondria	IMP	15685448
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IBA
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IMP	26244642
GO:0098586	Process	Cellular response to virus	IMP	26244642
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IMP	15685448

MIM	HGNC	e!Ensembl
147572	4054	ENSG00000126709

P09912

Protein name

Interferon alpha-inducible protein 6 (Interferon-induced protein 6-16) (Ifi-6-16)

Protein function

Interferon-stimulated protein that plays an important role in innate immune response against a wide variety of viruses (PubMed:31142663). Inhibits flavivirus replication by preventing the formation of virus-induced endoplasmic reticulum membrane

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06140	Ifi-6-16	41 → 119	Interferon-induced 6-16 family	Family

Sequence

MRQKAVSLFLCYLLLFTCSGVEAGKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALG
FTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATH
KYLDSEEDEE

Sequence length

130

Interactions

View interactions

	Reactome
			Interferon alpha/beta signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DEPRESSIVE DISORDER, MAJOR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (42)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult type dermatomyositis	Dermatomyositis	BEFREE	30383435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	15685448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	23148572	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15647832, 29899394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12841681, 29899394, 34055036, 35075167, 36766731	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35301803	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24098334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36596524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Allergic Contact	Allergic contact dermatitis	Pubtator	35028126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	30383435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	35609018, 35711463, 37353938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Desmoid disease hereditary	Desmoid tumor	Pubtator	33444924	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	39490745	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	30988500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	35301803	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	25757571	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	30199576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Involutional Depression	Involutional Depression	CTD_human_DG	29175309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Involutional paraphrenia	Involutional Paraphrenia	CTD_human_DG	29175309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	23428850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	27257790	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	33468161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	23428850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	16143398, 23428850, 27257790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	23428850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	CTD_human_DG	29175309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15647832, 29899394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17823654, 20939681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	36333264	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	37400835	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	17823654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	17823654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	16504146	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	25338682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	35609018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	20377629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	38115636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychosis, Involutional	Psychosis	CTD_human_DG	29175309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	33253099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18254958, 28176846	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15685448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

IFI6 (interferon alpha inducible protein 6)