Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	253559
Gene name	Cell adhesion molecule 2
Gene symbol	CADM2
Synonyms (NCBI Gene)	IGSF4DNECL3Necl-3SynCAM 2SynCAM-2synCAM2
Chromosome	3
Chromosome location	3p12.1
Summary	This gene encodes a member of the synaptic cell adhesion molecule 1 (SynCAM) family which belongs to the immunoglobulin (Ig) superfamily. The encoded protein has three Ig-like domains and a cytosolic protein 4.1 binding site near the C-terminus. Proteins

328

Show/Hide all (328)

miRTarBase ID	miRNA	Experiments	Reference
MIRT053422	hsa-miR-624-3p	Microarray	23807165
MIRT624473	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT624472	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT624471	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT624470	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT624469	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT624468	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT624466	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT624465	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT624467	hsa-miR-203a-3p	HITS-CLIP	23824327
MIRT624464	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT624463	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT624473	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT624472	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT624471	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT624470	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT624469	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT624468	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT624467	hsa-miR-203a-3p	HITS-CLIP	23824327
MIRT624466	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT624465	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT624464	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT624463	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT624462	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT616999	hsa-miR-489-3p	HITS-CLIP	23824327
MIRT450911	hsa-miR-888-3p	HITS-CLIP	23824327
MIRT616998	hsa-miR-6719-3p	HITS-CLIP	23824327
MIRT616997	hsa-miR-3913-3p	HITS-CLIP	23824327
MIRT450906	hsa-miR-4513	HITS-CLIP	23824327
MIRT450905	hsa-miR-6855-3p	HITS-CLIP	23824327
MIRT450904	hsa-miR-6857-3p	HITS-CLIP	23824327
MIRT450903	hsa-miR-3136-5p	HITS-CLIP	23824327
MIRT450902	hsa-miR-4439	HITS-CLIP	23824327
MIRT450901	hsa-miR-943	HITS-CLIP	23824327
MIRT569080	hsa-miR-548aa	PAR-CLIP	20371350
MIRT569079	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT569078	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT569077	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT569076	hsa-miR-548at-3p	PAR-CLIP	20371350
MIRT569075	hsa-miR-548ay-3p	PAR-CLIP	20371350
MIRT569074	hsa-miR-4717-5p	PAR-CLIP	20371350
MIRT569073	hsa-miR-15a-3p	PAR-CLIP	20371350
MIRT569072	hsa-miR-1295b-3p	PAR-CLIP	20371350
MIRT569071	hsa-miR-4529-5p	PAR-CLIP	20371350
MIRT569070	hsa-miR-5704	PAR-CLIP	20371350
MIRT569080	hsa-miR-548aa	PAR-CLIP	20371350
MIRT569079	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT569078	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT569077	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT569076	hsa-miR-548at-3p	PAR-CLIP	20371350
MIRT569075	hsa-miR-548ay-3p	PAR-CLIP	20371350
MIRT569074	hsa-miR-4717-5p	PAR-CLIP	20371350
MIRT569073	hsa-miR-15a-3p	PAR-CLIP	20371350
MIRT569072	hsa-miR-1295b-3p	PAR-CLIP	20371350
MIRT569071	hsa-miR-4529-5p	PAR-CLIP	20371350
MIRT569070	hsa-miR-5704	PAR-CLIP	20371350
MIRT569080	hsa-miR-548aa	PAR-CLIP	20371350
MIRT569079	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT569078	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT569077	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT569076	hsa-miR-548at-3p	PAR-CLIP	20371350
MIRT569075	hsa-miR-548ay-3p	PAR-CLIP	20371350
MIRT569074	hsa-miR-4717-5p	PAR-CLIP	20371350
MIRT569073	hsa-miR-15a-3p	PAR-CLIP	20371350
MIRT569072	hsa-miR-1295b-3p	PAR-CLIP	20371350
MIRT569071	hsa-miR-4529-5p	PAR-CLIP	20371350
MIRT569070	hsa-miR-5704	PAR-CLIP	20371350
MIRT569080	hsa-miR-548aa	PAR-CLIP	20371350
MIRT569079	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT569078	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT569077	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT569076	hsa-miR-548at-3p	PAR-CLIP	20371350
MIRT569075	hsa-miR-548ay-3p	PAR-CLIP	20371350
MIRT569074	hsa-miR-4717-5p	PAR-CLIP	20371350
MIRT569073	hsa-miR-15a-3p	PAR-CLIP	20371350
MIRT569072	hsa-miR-1295b-3p	PAR-CLIP	20371350
MIRT569071	hsa-miR-4529-5p	PAR-CLIP	20371350
MIRT569070	hsa-miR-5704	PAR-CLIP	20371350
MIRT450934	hsa-miR-302d-3p	PAR-CLIP	22100165
MIRT450932	hsa-miR-302a-3p	PAR-CLIP	22100165
MIRT450931	hsa-miR-520d-3p	PAR-CLIP	22100165
MIRT450930	hsa-miR-302e	PAR-CLIP	22100165
MIRT450929	hsa-miR-302b-3p	PAR-CLIP	22100165
MIRT450928	hsa-miR-302c-3p	PAR-CLIP	22100165
MIRT450927	hsa-miR-520e	PAR-CLIP	22100165
MIRT450926	hsa-miR-520c-3p	PAR-CLIP	22100165
MIRT450925	hsa-miR-520b	PAR-CLIP	22100165
MIRT450924	hsa-miR-520a-3p	PAR-CLIP	22100165
MIRT450923	hsa-miR-373-3p	PAR-CLIP	22100165
MIRT450922	hsa-miR-372-3p	PAR-CLIP	22100165
MIRT450921	hsa-miR-106b-5p	PAR-CLIP	22100165
MIRT450920	hsa-miR-519d-3p	PAR-CLIP	22100165
MIRT450919	hsa-miR-20b-5p	PAR-CLIP	22100165
MIRT450918	hsa-miR-93-5p	PAR-CLIP	22100165
MIRT450917	hsa-miR-526b-3p	PAR-CLIP	22100165
MIRT450916	hsa-miR-106a-5p	PAR-CLIP	22100165
MIRT450915	hsa-miR-20a-5p	PAR-CLIP	22100165
MIRT450914	hsa-miR-17-5p	PAR-CLIP	22100165
MIRT450913	hsa-miR-548az-5p	PAR-CLIP	22100165
MIRT450912	hsa-miR-548t-5p	PAR-CLIP	22100165
MIRT450911	hsa-miR-888-3p	PAR-CLIP	22100165
MIRT450910	hsa-miR-512-3p	PAR-CLIP	22100165
MIRT450908	hsa-miR-6074	PAR-CLIP	22100165
MIRT450909	hsa-miR-4778-5p	PAR-CLIP	22100165
MIRT450907	hsa-miR-4766-5p	PAR-CLIP	22100165
MIRT450906	hsa-miR-4513	PAR-CLIP	22100165
MIRT450905	hsa-miR-6855-3p	PAR-CLIP	22100165
MIRT450904	hsa-miR-6857-3p	PAR-CLIP	22100165
MIRT450903	hsa-miR-3136-5p	PAR-CLIP	22100165
MIRT450902	hsa-miR-4439	PAR-CLIP	22100165
MIRT450901	hsa-miR-943	PAR-CLIP	22100165
MIRT450900	hsa-miR-1273e	PAR-CLIP	22100165
MIRT448976	hsa-miR-410-3p	PAR-CLIP	22100165
MIRT448974	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT448973	hsa-miR-578	PAR-CLIP	22100165
MIRT448972	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT450922	hsa-miR-372-3p	Luciferase reporter assayWestern blottingqRT-PCR	31637209
MIRT624473	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT624472	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT624471	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT624470	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT624469	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT624468	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT624466	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT624465	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT624467	hsa-miR-203a-3p	HITS-CLIP	23824327
MIRT624464	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT624463	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT624473	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT624472	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT624471	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT624470	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT624469	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT624468	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT624467	hsa-miR-203a-3p	HITS-CLIP	23824327
MIRT624466	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT624465	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT624464	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT624463	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT624462	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT616999	hsa-miR-489-3p	HITS-CLIP	23824327
MIRT450911	hsa-miR-888-3p	HITS-CLIP	23824327
MIRT616998	hsa-miR-6719-3p	HITS-CLIP	23824327
MIRT616997	hsa-miR-3913-3p	HITS-CLIP	23824327
MIRT450906	hsa-miR-4513	HITS-CLIP	23824327
MIRT450905	hsa-miR-6855-3p	HITS-CLIP	23824327
MIRT450904	hsa-miR-6857-3p	HITS-CLIP	23824327
MIRT450903	hsa-miR-3136-5p	HITS-CLIP	23824327
MIRT450902	hsa-miR-4439	HITS-CLIP	23824327
MIRT450901	hsa-miR-943	HITS-CLIP	23824327
MIRT569080	hsa-miR-548aa	PAR-CLIP	20371350
MIRT569079	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT569078	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT569077	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT569076	hsa-miR-548at-3p	PAR-CLIP	20371350
MIRT569075	hsa-miR-548ay-3p	PAR-CLIP	20371350
MIRT569074	hsa-miR-4717-5p	PAR-CLIP	20371350
MIRT569073	hsa-miR-15a-3p	PAR-CLIP	20371350
MIRT569072	hsa-miR-1295b-3p	PAR-CLIP	20371350
MIRT569071	hsa-miR-4529-5p	PAR-CLIP	20371350
MIRT569070	hsa-miR-5704	PAR-CLIP	20371350
MIRT569080	hsa-miR-548aa	PAR-CLIP	20371350
MIRT569079	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT569078	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT569077	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT569076	hsa-miR-548at-3p	PAR-CLIP	20371350
MIRT569075	hsa-miR-548ay-3p	PAR-CLIP	20371350
MIRT569074	hsa-miR-4717-5p	PAR-CLIP	20371350
MIRT569073	hsa-miR-15a-3p	PAR-CLIP	20371350
MIRT569072	hsa-miR-1295b-3p	PAR-CLIP	20371350
MIRT569071	hsa-miR-4529-5p	PAR-CLIP	20371350
MIRT569070	hsa-miR-5704	PAR-CLIP	20371350
MIRT569080	hsa-miR-548aa	PAR-CLIP	20371350
MIRT569079	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT569078	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT569077	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT569076	hsa-miR-548at-3p	PAR-CLIP	20371350
MIRT569075	hsa-miR-548ay-3p	PAR-CLIP	20371350
MIRT569074	hsa-miR-4717-5p	PAR-CLIP	20371350
MIRT569073	hsa-miR-15a-3p	PAR-CLIP	20371350
MIRT569072	hsa-miR-1295b-3p	PAR-CLIP	20371350
MIRT569071	hsa-miR-4529-5p	PAR-CLIP	20371350
MIRT569070	hsa-miR-5704	PAR-CLIP	20371350
MIRT569080	hsa-miR-548aa	PAR-CLIP	20371350
MIRT569079	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT569078	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT569077	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT569076	hsa-miR-548at-3p	PAR-CLIP	20371350
MIRT569075	hsa-miR-548ay-3p	PAR-CLIP	20371350
MIRT569074	hsa-miR-4717-5p	PAR-CLIP	20371350
MIRT569073	hsa-miR-15a-3p	PAR-CLIP	20371350
MIRT569072	hsa-miR-1295b-3p	PAR-CLIP	20371350
MIRT569071	hsa-miR-4529-5p	PAR-CLIP	20371350
MIRT569070	hsa-miR-5704	PAR-CLIP	20371350
MIRT450934	hsa-miR-302d-3p	PAR-CLIP	22100165
MIRT450932	hsa-miR-302a-3p	PAR-CLIP	22100165
MIRT450931	hsa-miR-520d-3p	PAR-CLIP	22100165
MIRT450930	hsa-miR-302e	PAR-CLIP	22100165
MIRT450929	hsa-miR-302b-3p	PAR-CLIP	22100165
MIRT450928	hsa-miR-302c-3p	PAR-CLIP	22100165
MIRT450927	hsa-miR-520e	PAR-CLIP	22100165
MIRT450926	hsa-miR-520c-3p	PAR-CLIP	22100165
MIRT450925	hsa-miR-520b	PAR-CLIP	22100165
MIRT450924	hsa-miR-520a-3p	PAR-CLIP	22100165
MIRT450923	hsa-miR-373-3p	PAR-CLIP	22100165
MIRT450922	hsa-miR-372-3p	PAR-CLIP	22100165
MIRT450921	hsa-miR-106b-5p	PAR-CLIP	22100165
MIRT450920	hsa-miR-519d-3p	PAR-CLIP	22100165
MIRT450919	hsa-miR-20b-5p	PAR-CLIP	22100165
MIRT450918	hsa-miR-93-5p	PAR-CLIP	22100165
MIRT450917	hsa-miR-526b-3p	PAR-CLIP	22100165
MIRT450916	hsa-miR-106a-5p	PAR-CLIP	22100165
MIRT450915	hsa-miR-20a-5p	PAR-CLIP	22100165
MIRT450914	hsa-miR-17-5p	PAR-CLIP	22100165
MIRT450913	hsa-miR-548az-5p	PAR-CLIP	22100165
MIRT450912	hsa-miR-548t-5p	PAR-CLIP	22100165
MIRT450911	hsa-miR-888-3p	PAR-CLIP	22100165
MIRT450910	hsa-miR-512-3p	PAR-CLIP	22100165
MIRT450908	hsa-miR-6074	PAR-CLIP	22100165
MIRT450909	hsa-miR-4778-5p	PAR-CLIP	22100165
MIRT450907	hsa-miR-4766-5p	PAR-CLIP	22100165
MIRT450906	hsa-miR-4513	PAR-CLIP	22100165
MIRT450905	hsa-miR-6855-3p	PAR-CLIP	22100165
MIRT450904	hsa-miR-6857-3p	PAR-CLIP	22100165
MIRT450903	hsa-miR-3136-5p	PAR-CLIP	22100165
MIRT450902	hsa-miR-4439	PAR-CLIP	22100165
MIRT450901	hsa-miR-943	PAR-CLIP	22100165
MIRT450900	hsa-miR-1273e	PAR-CLIP	22100165
MIRT448976	hsa-miR-410-3p	PAR-CLIP	22100165
MIRT448974	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT448973	hsa-miR-578	PAR-CLIP	22100165
MIRT448972	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT858524	hsa-miR-1261	CLIP-seq
MIRT858525	hsa-miR-298	CLIP-seq
MIRT858526	hsa-miR-3201	CLIP-seq
MIRT858527	hsa-miR-3529	CLIP-seq
MIRT858528	hsa-miR-376a	CLIP-seq
MIRT858529	hsa-miR-376b	CLIP-seq
MIRT858530	hsa-miR-379	CLIP-seq
MIRT858531	hsa-miR-4328	CLIP-seq
MIRT858532	hsa-miR-4451	CLIP-seq
MIRT858533	hsa-miR-4650-3p	CLIP-seq
MIRT858534	hsa-miR-4791	CLIP-seq
MIRT858535	hsa-miR-101	CLIP-seq
MIRT858536	hsa-miR-144	CLIP-seq
MIRT858537	hsa-miR-4274	CLIP-seq
MIRT858538	hsa-miR-4519	CLIP-seq
MIRT858539	hsa-miR-4778-3p	CLIP-seq
MIRT858540	hsa-miR-1208	CLIP-seq
MIRT858541	hsa-miR-1279	CLIP-seq
MIRT858542	hsa-miR-1915	CLIP-seq
MIRT858543	hsa-miR-203	CLIP-seq
MIRT858544	hsa-miR-25	CLIP-seq
MIRT858545	hsa-miR-2682	CLIP-seq
MIRT858546	hsa-miR-297	CLIP-seq
MIRT858547	hsa-miR-3119	CLIP-seq
MIRT858548	hsa-miR-3140-3p	CLIP-seq
MIRT858549	hsa-miR-3148	CLIP-seq
MIRT858550	hsa-miR-3150a-3p	CLIP-seq
MIRT858551	hsa-miR-3175	CLIP-seq
MIRT858552	hsa-miR-32	CLIP-seq
MIRT858553	hsa-miR-323b-3p	CLIP-seq
MIRT858554	hsa-miR-33a	CLIP-seq
MIRT858555	hsa-miR-33b	CLIP-seq
MIRT858556	hsa-miR-3613-3p	CLIP-seq
MIRT858557	hsa-miR-363	CLIP-seq
MIRT858558	hsa-miR-3646	CLIP-seq
MIRT858559	hsa-miR-3662	CLIP-seq
MIRT858560	hsa-miR-367	CLIP-seq
MIRT858561	hsa-miR-3976	CLIP-seq
MIRT858562	hsa-miR-410	CLIP-seq
MIRT858563	hsa-miR-4272	CLIP-seq
MIRT858564	hsa-miR-4282	CLIP-seq
MIRT858565	hsa-miR-4423-3p	CLIP-seq
MIRT858566	hsa-miR-4495	CLIP-seq
MIRT858567	hsa-miR-449c	CLIP-seq
MIRT858568	hsa-miR-4501	CLIP-seq
MIRT858569	hsa-miR-4651	CLIP-seq
MIRT858570	hsa-miR-4659a-3p	CLIP-seq
MIRT858571	hsa-miR-4659b-3p	CLIP-seq
MIRT858572	hsa-miR-4699-5p	CLIP-seq
MIRT858573	hsa-miR-4709-3p	CLIP-seq
MIRT858574	hsa-miR-4724-3p	CLIP-seq
MIRT858575	hsa-miR-4726-3p	CLIP-seq
MIRT858576	hsa-miR-4797-5p	CLIP-seq
MIRT858577	hsa-miR-486-5p	CLIP-seq
MIRT858578	hsa-miR-491-5p	CLIP-seq
MIRT858579	hsa-miR-498	CLIP-seq
MIRT858580	hsa-miR-520d-5p	CLIP-seq
MIRT858581	hsa-miR-524-5p	CLIP-seq
MIRT858582	hsa-miR-548c-3p	CLIP-seq
MIRT858583	hsa-miR-548p	CLIP-seq
MIRT858584	hsa-miR-567	CLIP-seq
MIRT858585	hsa-miR-608	CLIP-seq
MIRT858586	hsa-miR-92a	CLIP-seq
MIRT858587	hsa-miR-92b	CLIP-seq
MIRT858588	hsa-miR-939	CLIP-seq
MIRT858589	hsa-miR-940	CLIP-seq
MIRT1954958	hsa-miR-129-5p	CLIP-seq
MIRT858540	hsa-miR-1208	CLIP-seq
MIRT858543	hsa-miR-203	CLIP-seq
MIRT2192542	hsa-miR-218	CLIP-seq
MIRT2192543	hsa-miR-3143	CLIP-seq
MIRT2192544	hsa-miR-3910	CLIP-seq
MIRT858561	hsa-miR-3976	CLIP-seq
MIRT2192545	hsa-miR-4422	CLIP-seq
MIRT2192546	hsa-miR-4424	CLIP-seq
MIRT2192547	hsa-miR-4719	CLIP-seq
MIRT2192548	hsa-miR-499-3p	CLIP-seq
MIRT2192549	hsa-miR-499a-3p	CLIP-seq
MIRT2192550	hsa-miR-543	CLIP-seq
MIRT2192551	hsa-miR-548an	CLIP-seq
MIRT2192552	hsa-miR-548t	CLIP-seq
MIRT2192553	hsa-miR-636	CLIP-seq
MIRT858527	hsa-miR-3529	CLIP-seq
MIRT858530	hsa-miR-379	CLIP-seq
MIRT858532	hsa-miR-4451	CLIP-seq
MIRT858533	hsa-miR-4650-3p	CLIP-seq
MIRT2465032	hsa-miR-4729	CLIP-seq
MIRT2495779	hsa-miR-23a	CLIP-seq
MIRT2495780	hsa-miR-23b	CLIP-seq
MIRT2495781	hsa-miR-23c	CLIP-seq
MIRT2495782	hsa-miR-4318	CLIP-seq
MIRT2495783	hsa-miR-4693-5p	CLIP-seq
MIRT858582	hsa-miR-548c-3p	CLIP-seq
MIRT2495784	hsa-miR-592	CLIP-seq
MIRT2495785	hsa-miR-597	CLIP-seq
MIRT2495786	hsa-miR-892a	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IBA
GO:0016020	Component	Membrane	IEA
GO:0030424	Component	Axon	IEA
GO:0032809	Component	Neuronal cell body membrane	IBA
GO:0042995	Component	Cell projection	IEA
GO:0045202	Component	Synapse	IEA

MIM	HGNC	e!Ensembl
609938	29849	ENSG00000175161

Q8N3J6

Protein name

Cell adhesion molecule 2 (Immunoglobulin superfamily member 4D) (IgSF4D) (Nectin-like protein 3) (NECL-3) (Synaptic cell adhesion molecule 2) (SynCAM 2)

Protein function

Adhesion molecule that engages in homo- and heterophilic interactions with the other nectin-like family members, leading to cell aggregation. Important for synapse organization, providing regulated trans-synaptic adhesion. Preferentially binds t

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	28 → 121	Immunoglobulin V-set domain	Domain
PF08205	C2-set_2	126 → 213	CD80-like C2-set immunoglobulin domain	Domain
PF13927	Ig_3	226 → 300		Domain

Sequence

MIWKRSAVLRFYSVCGLLLQGSQGQFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPA
QQTLYFDDKKALRDNRIELVRASWHELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYLTV
LGVPEKPQISGFSSPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDANRK
TFTVSSTLDFRVDRSDDGVAVICRVDHESLNATPQVAMQVLEIHYTPSVKIIPSTPFPQE
GQPLILTCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRELNILFLNKTDNGTYRCEATN
TIGQSSAEYVLIVHDVPNTLLPTTIIPSLTTATVTTTVAITTSPTTSATTSSIRDPNALA
GQNGPDHALIGGIVAVVVFVTLCSIFLLGRYLARHKGTYLTNEAKGAEDAPDADTAIINA
EGSQVNAEEKKEYFI

Sequence length

435

Interactions

View interactions

	Reactome
			Adherens junctions interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (35)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS DEPENDENCE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC BRONCHITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLEXIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EYE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRRITABLE BOWEL SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSTRUCTIVE SLEEP APNEA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ROLANDIC EPILEPSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (53)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	27046643, 29899525	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety	Anxiety Disorder	GWASCAT_DG	29942085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	34741163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	36774336, 38335780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	21996756	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	27023175, 28973307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	28973307, 36150388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behavior Disorders	Behavior Disorders	BEFREE	29039453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	GWASDB_DG	22182935		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	31043756		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	33168801	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	37228062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29506532	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37228062, 38126999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34222474	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36576985	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23643812, 30184528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressed bipolar I disorder	Depressed bipolar disorder	GWASCAT_DG	31043756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28401323		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Disruptive Impulse Control and Conduct Disorders	Disruptive, impulse control, and conduct disorders	Pubtator	30718321	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	22276910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	35509074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	GWASCAT_DG	30054594, 30104761		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma, Open-Angle	Glaucoma	GWASCAT_DG	29891935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30816549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29217450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	34741163	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24240726, 29506532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	37228062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21062931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21062931, 23643812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory disorders	Pubtator	36774336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29217450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21062931, 23643812, 24240726, 29506532, 29680210, 30184528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	27046643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22618246, 24890885, 29217450, 31089183		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	23539184, 29899525, 31341224	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	GWASCAT_DG	23563607		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	GWASDB_DG	23563607		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31856624	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	28973307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21062931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21062931	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21307934	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	21864505		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23643812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	30320366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	27046643, 28973307, 33346031, 35509074	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	31374203		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29680210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	29341891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	29341891		★★★★★ ★☆☆☆☆ Found in Text Mining only

CADM2 (cell adhesion molecule 2)