RICTOR (RPTOR independent companion of MTOR complex 2)

Gene

• Entrez ID: 253260
• Gene name: RPTOR independent companion of MTOR complex 2
• Gene symbol: RICTOR
• Synonyms (NCBI Gene): AVO3, PIA, hAVO3
• Chromosome: 5
• Chromosome location: 5p13.1
• Summary: RICTOR and MTOR (FRAP1; MIM 601231) are components of a protein complex that integrates nutrient- and growth factor-derived signals to regulate cell growth (Sarbassov et al., 2004 [PubMed 15268862]).[supplied by OMIM, Mar 2008]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1554059320	T>-	Likely-pathogenic	Coding sequence variant, frameshift variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006105	hsa-miR-218-5p	Luciferase reporter assay, qRT-PCR, Western blot	21795477
MIRT006105	hsa-miR-218-5p	Luciferase reporter assay, qRT-PCR, Western blot	21795477
MIRT006105	hsa-miR-218-5p	Luciferase reporter assay, qRT-PCR, Western blot	21795477
MIRT006105	hsa-miR-218-5p	Luciferase reporter assay, qRT-PCR, Western blot	21795477
MIRT006105	hsa-miR-218-5p	Luciferase reporter assay, qRT-PCR, Western blot	21795477
MIRT006105	hsa-miR-218-5p	Luciferase reporter assay, qRT-PCR, Western blot	21795477
MIRT006105	hsa-miR-218-5p	HITS-CLIP, Luciferase reporter assay, Western blot	23212916
MIRT018260	hsa-miR-335-5p	Microarray	18185580
MIRT020841	hsa-miR-155-5p	Proteomics	18668040
MIRT006105	hsa-miR-218-5p	Sequencing	20371350
MIRT050668	hsa-miR-18a-5p	CLASH	23622248
MIRT038935	hsa-miR-31-3p	CLASH	23622248
MIRT437348	hsa-let-7c-5p	Luciferase reporter assay	25311506
MIRT437348	hsa-let-7c-5p	Luciferase reporter assay	25311506
MIRT437349	hsa-miR-16-5p	Luciferase reporter assay	25311506
MIRT437349	hsa-miR-16-5p	Luciferase reporter assay	25311506
MIRT654263	hsa-miR-362-5p	HITS-CLIP	23824327
MIRT654262	hsa-miR-500b-5p	HITS-CLIP	23824327
MIRT654261	hsa-miR-3927-5p	HITS-CLIP	23824327
MIRT391490	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT654260	hsa-miR-3160-5p	HITS-CLIP	23824327
MIRT654259	hsa-miR-337-3p	HITS-CLIP	23824327
MIRT654258	hsa-miR-202-5p	HITS-CLIP	23824327
MIRT654257	hsa-miR-6509-5p	HITS-CLIP	23824327
MIRT654256	hsa-miR-3685	HITS-CLIP	23824327
MIRT654255	hsa-miR-384	HITS-CLIP	23824327
MIRT469218	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT469217	hsa-miR-6841-5p	PAR-CLIP	23592263
MIRT469216	hsa-miR-1245a	PAR-CLIP	23592263
MIRT469215	hsa-miR-8079	PAR-CLIP	23592263
MIRT469214	hsa-miR-8062	PAR-CLIP	23592263
MIRT469213	hsa-miR-8069	PAR-CLIP	23592263
MIRT469212	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT469211	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT469210	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT469209	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT469207	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT469208	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT469205	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT469206	hsa-miR-5698	PAR-CLIP	23592263
MIRT469204	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT469203	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT469202	hsa-miR-4525	PAR-CLIP	23592263
MIRT469201	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT469200	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT469199	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT469198	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT166223	hsa-miR-6747-5p	PAR-CLIP	23592263
MIRT469197	hsa-miR-541-3p	PAR-CLIP	23592263
MIRT469196	hsa-miR-654-5p	PAR-CLIP	23592263
MIRT469195	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT469194	hsa-miR-6769a-5p	PAR-CLIP	23592263
MIRT469193	hsa-miR-6769b-5p	PAR-CLIP	23592263
MIRT469192	hsa-miR-4447	PAR-CLIP	23592263
MIRT469191	hsa-miR-4472	PAR-CLIP	23592263
MIRT469190	hsa-miR-1275	PAR-CLIP	23592263
MIRT469189	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT439769	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT006105	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439769	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT006105	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439769	hsa-miR-142-3p	Western blotting, qRT-PCR, Flow cytometry	31930050
MIRT654263	hsa-miR-362-5p	HITS-CLIP	23824327
MIRT654262	hsa-miR-500b-5p	HITS-CLIP	23824327
MIRT654261	hsa-miR-3927-5p	HITS-CLIP	23824327
MIRT391490	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT654260	hsa-miR-3160-5p	HITS-CLIP	23824327
MIRT654259	hsa-miR-337-3p	HITS-CLIP	23824327
MIRT654258	hsa-miR-202-5p	HITS-CLIP	23824327
MIRT654257	hsa-miR-6509-5p	HITS-CLIP	23824327
MIRT654256	hsa-miR-3685	HITS-CLIP	23824327
MIRT654255	hsa-miR-384	HITS-CLIP	23824327
MIRT469218	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT469217	hsa-miR-6841-5p	PAR-CLIP	23592263
MIRT469216	hsa-miR-1245a	PAR-CLIP	23592263
MIRT469215	hsa-miR-8079	PAR-CLIP	23592263
MIRT469214	hsa-miR-8062	PAR-CLIP	23592263
MIRT469213	hsa-miR-8069	PAR-CLIP	23592263
MIRT469212	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT469211	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT469210	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT469209	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT469207	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT469208	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT469205	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT469206	hsa-miR-5698	PAR-CLIP	23592263
MIRT469204	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT469203	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT469202	hsa-miR-4525	PAR-CLIP	23592263
MIRT469201	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT469200	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT469199	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT469198	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT166223	hsa-miR-6747-5p	PAR-CLIP	23592263
MIRT469197	hsa-miR-541-3p	PAR-CLIP	23592263
MIRT469196	hsa-miR-654-5p	PAR-CLIP	23592263
MIRT469195	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT469194	hsa-miR-6769a-5p	PAR-CLIP	23592263
MIRT469193	hsa-miR-6769b-5p	PAR-CLIP	23592263
MIRT469192	hsa-miR-4447	PAR-CLIP	23592263
MIRT469191	hsa-miR-4472	PAR-CLIP	23592263
MIRT469190	hsa-miR-1275	PAR-CLIP	23592263
MIRT469189	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT755974	hsa-miR-3188	Luciferase reporter assay, Western blotting, qRT-PCR, in vitro cullelar assays	34848471
MIRT756111	hsa-mir-192-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunofluorescence	38152335
MIRT1306508	hsa-miR-101	CLIP-seq
MIRT1306509	hsa-miR-1183	CLIP-seq
MIRT1306510	hsa-miR-1265	CLIP-seq
MIRT1306511	hsa-miR-1271	CLIP-seq
MIRT1306512	hsa-miR-1273d	CLIP-seq
MIRT1306513	hsa-miR-1276	CLIP-seq
MIRT1306514	hsa-miR-1283	CLIP-seq
MIRT1306515	hsa-miR-1304	CLIP-seq
MIRT1306516	hsa-miR-135a	CLIP-seq
MIRT1306517	hsa-miR-135b	CLIP-seq
MIRT1306518	hsa-miR-139-5p	CLIP-seq
MIRT1306519	hsa-miR-144	CLIP-seq
MIRT1306520	hsa-miR-154	CLIP-seq
MIRT1306521	hsa-miR-155	CLIP-seq
MIRT1306522	hsa-miR-15a	CLIP-seq
MIRT1306523	hsa-miR-15b	CLIP-seq
MIRT1306524	hsa-miR-16	CLIP-seq
MIRT1306525	hsa-miR-182	CLIP-seq
MIRT1306526	hsa-miR-188-5p	CLIP-seq
MIRT1306527	hsa-miR-195	CLIP-seq
MIRT1306528	hsa-miR-203	CLIP-seq
MIRT1306529	hsa-miR-204	CLIP-seq
MIRT1306530	hsa-miR-2054	CLIP-seq
MIRT1306531	hsa-miR-211	CLIP-seq
MIRT1306532	hsa-miR-2392	CLIP-seq
MIRT1306533	hsa-miR-3065-5p	CLIP-seq
MIRT1306534	hsa-miR-3119	CLIP-seq
MIRT1306535	hsa-miR-3148	CLIP-seq
MIRT1306536	hsa-miR-3160-3p	CLIP-seq
MIRT1306537	hsa-miR-3161	CLIP-seq
MIRT1306538	hsa-miR-3182	CLIP-seq
MIRT1306539	hsa-miR-3183	CLIP-seq
MIRT755974	hsa-miR-3188	CLIP-seq
MIRT1306540	hsa-miR-3190	CLIP-seq
MIRT1306541	hsa-miR-340	CLIP-seq
MIRT1306542	hsa-miR-3591-3p	CLIP-seq
MIRT1306543	hsa-miR-3606	CLIP-seq
MIRT1306544	hsa-miR-3607-3p	CLIP-seq
MIRT1306545	hsa-miR-3646	CLIP-seq
MIRT1306546	hsa-miR-365	CLIP-seq
MIRT1306547	hsa-miR-3662	CLIP-seq
MIRT1306548	hsa-miR-3668	CLIP-seq
MIRT1306549	hsa-miR-3689a-5p	CLIP-seq
MIRT1306550	hsa-miR-3689b	CLIP-seq
MIRT1306551	hsa-miR-3689e	CLIP-seq
MIRT1306552	hsa-miR-3689f	CLIP-seq
MIRT1306553	hsa-miR-3713	CLIP-seq
MIRT1306554	hsa-miR-3921	CLIP-seq
MIRT1306555	hsa-miR-3973	CLIP-seq
MIRT1306556	hsa-miR-3977	CLIP-seq
MIRT1306557	hsa-miR-3978	CLIP-seq
MIRT1306558	hsa-miR-424	CLIP-seq
MIRT1306559	hsa-miR-4272	CLIP-seq
MIRT1306560	hsa-miR-4289	CLIP-seq
MIRT1306561	hsa-miR-4307	CLIP-seq
MIRT1306562	hsa-miR-4433	CLIP-seq
MIRT1306563	hsa-miR-4459	CLIP-seq
MIRT1306564	hsa-miR-4477a	CLIP-seq
MIRT1306565	hsa-miR-4477b	CLIP-seq
MIRT1306566	hsa-miR-4511	CLIP-seq
MIRT1306567	hsa-miR-4524	CLIP-seq
MIRT1306568	hsa-miR-4530	CLIP-seq
MIRT1306569	hsa-miR-4536	CLIP-seq
MIRT1306570	hsa-miR-4642	CLIP-seq
MIRT1306571	hsa-miR-4653-5p	CLIP-seq
MIRT1306572	hsa-miR-4659a-3p	CLIP-seq
MIRT1306573	hsa-miR-4659b-3p	CLIP-seq
MIRT1306574	hsa-miR-4668-3p	CLIP-seq
MIRT1306575	hsa-miR-4682	CLIP-seq
MIRT1306576	hsa-miR-4695-5p	CLIP-seq
MIRT1306577	hsa-miR-4698	CLIP-seq
MIRT1306578	hsa-miR-4709-3p	CLIP-seq
MIRT1306579	hsa-miR-4723-3p	CLIP-seq
MIRT1306580	hsa-miR-4724-3p	CLIP-seq
MIRT1306581	hsa-miR-4766-5p	CLIP-seq
MIRT1306582	hsa-miR-4768-3p	CLIP-seq
MIRT1306583	hsa-miR-4780	CLIP-seq
MIRT1306584	hsa-miR-4795-3p	CLIP-seq
MIRT1306585	hsa-miR-4796-3p	CLIP-seq
MIRT1306586	hsa-miR-486-5p	CLIP-seq
MIRT1306587	hsa-miR-489	CLIP-seq
MIRT1306588	hsa-miR-496	CLIP-seq
MIRT1306589	hsa-miR-497	CLIP-seq
MIRT1306590	hsa-miR-503	CLIP-seq
MIRT1306591	hsa-miR-518a-5p	CLIP-seq
MIRT1306592	hsa-miR-527	CLIP-seq
MIRT1306593	hsa-miR-548a-5p	CLIP-seq
MIRT1306594	hsa-miR-548ab	CLIP-seq
MIRT1306595	hsa-miR-548ac	CLIP-seq
MIRT1306596	hsa-miR-548ae	CLIP-seq
MIRT1306597	hsa-miR-548aj	CLIP-seq
MIRT1306598	hsa-miR-548ak	CLIP-seq
MIRT1306599	hsa-miR-548am	CLIP-seq
MIRT1306600	hsa-miR-548b-5p	CLIP-seq
MIRT1306601	hsa-miR-548c-5p	CLIP-seq
MIRT1306602	hsa-miR-548d-3p	CLIP-seq
MIRT1306603	hsa-miR-548d-5p	CLIP-seq
MIRT1306604	hsa-miR-548h	CLIP-seq
MIRT1306605	hsa-miR-548i	CLIP-seq
MIRT1306606	hsa-miR-548j	CLIP-seq
MIRT1306607	hsa-miR-548w	CLIP-seq
MIRT1306608	hsa-miR-548x	CLIP-seq
MIRT1306609	hsa-miR-548y	CLIP-seq
MIRT1306610	hsa-miR-548z	CLIP-seq
MIRT1306611	hsa-miR-559	CLIP-seq
MIRT1306612	hsa-miR-577	CLIP-seq
MIRT1306613	hsa-miR-590-3p	CLIP-seq
MIRT1306614	hsa-miR-634	CLIP-seq
MIRT1306615	hsa-miR-642a	CLIP-seq
MIRT1306616	hsa-miR-646	CLIP-seq
MIRT1306617	hsa-miR-660	CLIP-seq
MIRT1306618	hsa-miR-760	CLIP-seq
MIRT1306619	hsa-miR-889	CLIP-seq
MIRT1306620	hsa-miR-938	CLIP-seq
MIRT1306621	hsa-miR-96	CLIP-seq
MIRT2090824	hsa-miR-132	CLIP-seq
MIRT2090825	hsa-miR-142-5p	CLIP-seq
MIRT2090826	hsa-miR-143	CLIP-seq
MIRT2090827	hsa-miR-145	CLIP-seq
MIRT1306522	hsa-miR-15a	CLIP-seq
MIRT1306523	hsa-miR-15b	CLIP-seq
MIRT1306524	hsa-miR-16	CLIP-seq
MIRT2090828	hsa-miR-194	CLIP-seq
MIRT1306527	hsa-miR-195	CLIP-seq
MIRT2090829	hsa-miR-197	CLIP-seq
MIRT1306530	hsa-miR-2054	CLIP-seq
MIRT2090830	hsa-miR-212	CLIP-seq
MIRT2090831	hsa-miR-2467-5p	CLIP-seq
MIRT2090832	hsa-miR-3117-5p	CLIP-seq
MIRT2090833	hsa-miR-3121-5p	CLIP-seq
MIRT2090834	hsa-miR-3127-3p	CLIP-seq
MIRT2090835	hsa-miR-3140-3p	CLIP-seq
MIRT1306537	hsa-miR-3161	CLIP-seq
MIRT755974	hsa-miR-3188	CLIP-seq
MIRT2090836	hsa-miR-323-3p	CLIP-seq
MIRT1306544	hsa-miR-3607-3p	CLIP-seq
MIRT2090837	hsa-miR-3616-5p	CLIP-seq
MIRT1306545	hsa-miR-3646	CLIP-seq
MIRT2090838	hsa-miR-3647-5p	CLIP-seq
MIRT1306548	hsa-miR-3668	CLIP-seq
MIRT2090839	hsa-miR-3675-3p	CLIP-seq
MIRT2090840	hsa-miR-3679-3p	CLIP-seq
MIRT2090841	hsa-miR-3682-5p	CLIP-seq
MIRT2090842	hsa-miR-3686	CLIP-seq
MIRT2090843	hsa-miR-3689d	CLIP-seq
MIRT1306558	hsa-miR-424	CLIP-seq
MIRT2090844	hsa-miR-4276	CLIP-seq
MIRT2090845	hsa-miR-4277	CLIP-seq
MIRT1306561	hsa-miR-4307	CLIP-seq
MIRT2090846	hsa-miR-4420	CLIP-seq
MIRT2090847	hsa-miR-4424	CLIP-seq
MIRT2090848	hsa-miR-4443	CLIP-seq
MIRT2090849	hsa-miR-448	CLIP-seq
MIRT1306567	hsa-miR-4524	CLIP-seq
MIRT2090850	hsa-miR-4662a-3p	CLIP-seq
MIRT2090851	hsa-miR-4677-3p	CLIP-seq
MIRT2090852	hsa-miR-4679	CLIP-seq
MIRT2090853	hsa-miR-4712-5p	CLIP-seq
MIRT2090854	hsa-miR-4770	CLIP-seq
MIRT2090855	hsa-miR-4774-5p	CLIP-seq
MIRT1306584	hsa-miR-4795-3p	CLIP-seq
MIRT2090856	hsa-miR-4795-5p	CLIP-seq
MIRT1306589	hsa-miR-497	CLIP-seq
MIRT1306590	hsa-miR-503	CLIP-seq
MIRT2090857	hsa-miR-5096	CLIP-seq
MIRT2090858	hsa-miR-513a-3p	CLIP-seq
MIRT2090859	hsa-miR-513c	CLIP-seq
MIRT2090860	hsa-miR-514b-5p	CLIP-seq
MIRT2090861	hsa-miR-526b	CLIP-seq
MIRT2090862	hsa-miR-548aa	CLIP-seq
MIRT2090863	hsa-miR-548an	CLIP-seq
MIRT2090864	hsa-miR-548c-3p	CLIP-seq
MIRT2090865	hsa-miR-548p	CLIP-seq
MIRT2090866	hsa-miR-573	CLIP-seq
MIRT2090867	hsa-miR-607	CLIP-seq
MIRT2090868	hsa-miR-630	CLIP-seq
MIRT1306616	hsa-miR-646	CLIP-seq
MIRT2090869	hsa-miR-659	CLIP-seq
MIRT2090870	hsa-miR-770-5p	CLIP-seq
MIRT2090871	hsa-miR-802	CLIP-seq
MIRT1306619	hsa-miR-889	CLIP-seq
MIRT1306514	hsa-miR-1283	CLIP-seq
MIRT2090824	hsa-miR-132	CLIP-seq
MIRT2090825	hsa-miR-142-5p	CLIP-seq
MIRT1306521	hsa-miR-155	CLIP-seq
MIRT1306522	hsa-miR-15a	CLIP-seq
MIRT1306523	hsa-miR-15b	CLIP-seq
MIRT1306524	hsa-miR-16	CLIP-seq
MIRT2315481	hsa-miR-192	CLIP-seq
MIRT2090828	hsa-miR-194	CLIP-seq
MIRT1306527	hsa-miR-195	CLIP-seq
MIRT2090829	hsa-miR-197	CLIP-seq
MIRT2090830	hsa-miR-212	CLIP-seq
MIRT2315482	hsa-miR-215	CLIP-seq
MIRT2315483	hsa-miR-217	CLIP-seq
MIRT2315484	hsa-miR-2467-3p	CLIP-seq
MIRT2315485	hsa-miR-2682	CLIP-seq
MIRT2090832	hsa-miR-3117-5p	CLIP-seq
MIRT1306534	hsa-miR-3119	CLIP-seq
MIRT2090833	hsa-miR-3121-5p	CLIP-seq
MIRT1306537	hsa-miR-3161	CLIP-seq
MIRT2315486	hsa-miR-342-3p	CLIP-seq
MIRT1306542	hsa-miR-3591-3p	CLIP-seq
MIRT2090837	hsa-miR-3616-5p	CLIP-seq
MIRT2090838	hsa-miR-3647-5p	CLIP-seq
MIRT2315487	hsa-miR-3678-3p	CLIP-seq
MIRT1306549	hsa-miR-3689a-5p	CLIP-seq
MIRT1306550	hsa-miR-3689b	CLIP-seq
MIRT2090843	hsa-miR-3689d	CLIP-seq
MIRT1306551	hsa-miR-3689e	CLIP-seq
MIRT1306552	hsa-miR-3689f	CLIP-seq
MIRT2315488	hsa-miR-376a	CLIP-seq
MIRT2315489	hsa-miR-376b	CLIP-seq
MIRT1306555	hsa-miR-3973	CLIP-seq
MIRT1306558	hsa-miR-424	CLIP-seq
MIRT2090844	hsa-miR-4276	CLIP-seq
MIRT2090846	hsa-miR-4420	CLIP-seq
MIRT2090848	hsa-miR-4443	CLIP-seq
MIRT2315490	hsa-miR-4496	CLIP-seq
MIRT2315491	hsa-miR-449c	CLIP-seq
MIRT2315492	hsa-miR-4517	CLIP-seq
MIRT2315493	hsa-miR-4643	CLIP-seq
MIRT2315494	hsa-miR-466	CLIP-seq
MIRT2090850	hsa-miR-4662a-3p	CLIP-seq
MIRT2090851	hsa-miR-4677-3p	CLIP-seq
MIRT2090852	hsa-miR-4679	CLIP-seq
MIRT2315495	hsa-miR-4686	CLIP-seq
MIRT2315496	hsa-miR-4719	CLIP-seq
MIRT2315497	hsa-miR-4778-5p	CLIP-seq
MIRT2315498	hsa-miR-4789-3p	CLIP-seq
MIRT2315499	hsa-miR-4789-5p	CLIP-seq
MIRT2090856	hsa-miR-4795-5p	CLIP-seq
MIRT2315500	hsa-miR-4803	CLIP-seq
MIRT1306589	hsa-miR-497	CLIP-seq
MIRT2090857	hsa-miR-5096	CLIP-seq
MIRT2315501	hsa-miR-520d-5p	CLIP-seq
MIRT2315502	hsa-miR-524-5p	CLIP-seq
MIRT2090861	hsa-miR-526b	CLIP-seq
MIRT2315503	hsa-miR-548a-3p	CLIP-seq
MIRT1306593	hsa-miR-548a-5p	CLIP-seq
MIRT1306594	hsa-miR-548ab	CLIP-seq
MIRT2315504	hsa-miR-548ag	CLIP-seq
MIRT2315505	hsa-miR-548ai	CLIP-seq
MIRT1306598	hsa-miR-548ak	CLIP-seq
MIRT1306600	hsa-miR-548b-5p	CLIP-seq
MIRT1306601	hsa-miR-548c-5p	CLIP-seq
MIRT1306603	hsa-miR-548d-5p	CLIP-seq
MIRT2315506	hsa-miR-548e	CLIP-seq
MIRT2315507	hsa-miR-548f	CLIP-seq
MIRT1306604	hsa-miR-548h	CLIP-seq
MIRT1306605	hsa-miR-548i	CLIP-seq
MIRT1306606	hsa-miR-548j	CLIP-seq
MIRT1306607	hsa-miR-548w	CLIP-seq
MIRT1306609	hsa-miR-548y	CLIP-seq
MIRT1306611	hsa-miR-559	CLIP-seq
MIRT2090866	hsa-miR-573	CLIP-seq
MIRT2090867	hsa-miR-607	CLIP-seq
MIRT1306614	hsa-miR-634	CLIP-seq
MIRT1306616	hsa-miR-646	CLIP-seq
MIRT2315508	hsa-miR-651	CLIP-seq
MIRT2315509	hsa-miR-654-3p	CLIP-seq
MIRT2090871	hsa-miR-802	CLIP-seq
MIRT1306619	hsa-miR-889	CLIP-seq
MIRT2315510	hsa-miR-934	CLIP-seq
MIRT1306620	hsa-miR-938	CLIP-seq
MIRT2315511	hsa-miR-940	CLIP-seq
MIRT2315512	hsa-miR-944	CLIP-seq
MIRT2090825	hsa-miR-142-5p	CLIP-seq
MIRT2090829	hsa-miR-197	CLIP-seq
MIRT2315483	hsa-miR-217	CLIP-seq
MIRT2393749	hsa-miR-218	CLIP-seq
MIRT2393750	hsa-miR-299-3p	CLIP-seq
MIRT2393751	hsa-miR-3151	CLIP-seq
MIRT2393752	hsa-miR-4450	CLIP-seq
MIRT2393753	hsa-miR-491-5p	CLIP-seq
MIRT2090857	hsa-miR-5096	CLIP-seq
MIRT2393754	hsa-miR-636	CLIP-seq
MIRT2439904	hsa-miR-29a	CLIP-seq
MIRT2439905	hsa-miR-29b	CLIP-seq
MIRT2439906	hsa-miR-29c	CLIP-seq
MIRT2439907	hsa-miR-377	CLIP-seq
MIRT2439908	hsa-miR-4639-3p	CLIP-seq
MIRT2458228	hsa-miR-1264	CLIP-seq
MIRT1306516	hsa-miR-135a	CLIP-seq
MIRT1306517	hsa-miR-135b	CLIP-seq
MIRT1306521	hsa-miR-155	CLIP-seq
MIRT2458229	hsa-miR-2053	CLIP-seq
MIRT2458230	hsa-miR-2355-5p	CLIP-seq
MIRT2315484	hsa-miR-2467-3p	CLIP-seq
MIRT2315487	hsa-miR-3678-3p	CLIP-seq
MIRT2090840	hsa-miR-3679-3p	CLIP-seq
MIRT2458231	hsa-miR-4251	CLIP-seq
MIRT2458232	hsa-miR-4329	CLIP-seq
MIRT2458233	hsa-miR-4778-3p	CLIP-seq
MIRT2090857	hsa-miR-5096	CLIP-seq
MIRT2458234	hsa-miR-513b	CLIP-seq
MIRT2458235	hsa-miR-569	CLIP-seq
MIRT1306618	hsa-miR-760	CLIP-seq
MIRT2611750	hsa-miR-1244	CLIP-seq
MIRT2611751	hsa-miR-1252	CLIP-seq
MIRT2611752	hsa-miR-1258	CLIP-seq
MIRT2458228	hsa-miR-1264	CLIP-seq
MIRT2611753	hsa-miR-1267	CLIP-seq
MIRT1306512	hsa-miR-1273d	CLIP-seq
MIRT2611754	hsa-miR-1273g	CLIP-seq
MIRT1306513	hsa-miR-1276	CLIP-seq
MIRT2611755	hsa-miR-1278	CLIP-seq
MIRT1306514	hsa-miR-1283	CLIP-seq
MIRT2611756	hsa-miR-1298	CLIP-seq
MIRT2611757	hsa-miR-1299	CLIP-seq
MIRT2611758	hsa-miR-1303	CLIP-seq
MIRT2090824	hsa-miR-132	CLIP-seq
MIRT2611759	hsa-miR-137	CLIP-seq
MIRT2090825	hsa-miR-142-5p	CLIP-seq
MIRT1306521	hsa-miR-155	CLIP-seq
MIRT1306522	hsa-miR-15a	CLIP-seq
MIRT1306523	hsa-miR-15b	CLIP-seq
MIRT1306524	hsa-miR-16	CLIP-seq
MIRT2611760	hsa-miR-185	CLIP-seq
MIRT2611761	hsa-miR-1913	CLIP-seq
MIRT2090828	hsa-miR-194	CLIP-seq
MIRT1306527	hsa-miR-195	CLIP-seq
MIRT1306528	hsa-miR-203	CLIP-seq
MIRT2611762	hsa-miR-2052	CLIP-seq
MIRT2458229	hsa-miR-2053	CLIP-seq
MIRT1306530	hsa-miR-2054	CLIP-seq
MIRT2611763	hsa-miR-2113	CLIP-seq
MIRT2611764	hsa-miR-2116	CLIP-seq
MIRT2611765	hsa-miR-2117	CLIP-seq
MIRT2090830	hsa-miR-212	CLIP-seq
MIRT2393749	hsa-miR-218	CLIP-seq
MIRT2458230	hsa-miR-2355-5p	CLIP-seq
MIRT2315484	hsa-miR-2467-3p	CLIP-seq
MIRT2315485	hsa-miR-2682	CLIP-seq
MIRT2393750	hsa-miR-299-3p	CLIP-seq
MIRT2439904	hsa-miR-29a	CLIP-seq
MIRT2439905	hsa-miR-29b	CLIP-seq
MIRT2439906	hsa-miR-29c	CLIP-seq
MIRT1306533	hsa-miR-3065-5p	CLIP-seq
MIRT2090832	hsa-miR-3117-5p	CLIP-seq
MIRT2611766	hsa-miR-3121-3p	CLIP-seq
MIRT2611767	hsa-miR-3133	CLIP-seq
MIRT2611768	hsa-miR-3143	CLIP-seq
MIRT2611769	hsa-miR-3145-5p	CLIP-seq
MIRT1306535	hsa-miR-3148	CLIP-seq
MIRT2393751	hsa-miR-3151	CLIP-seq
MIRT2611770	hsa-miR-3156-3p	CLIP-seq
MIRT2611771	hsa-miR-3163	CLIP-seq
MIRT1306539	hsa-miR-3183	CLIP-seq
MIRT2611772	hsa-miR-3189-5p	CLIP-seq
MIRT1306540	hsa-miR-3190	CLIP-seq
MIRT2090836	hsa-miR-323-3p	CLIP-seq
MIRT2611773	hsa-miR-324-3p	CLIP-seq
MIRT2611774	hsa-miR-326	CLIP-seq
MIRT2611775	hsa-miR-330-5p	CLIP-seq
MIRT2611776	hsa-miR-33a	CLIP-seq
MIRT2611777	hsa-miR-33b	CLIP-seq
MIRT1306542	hsa-miR-3591-3p	CLIP-seq
MIRT1306544	hsa-miR-3607-3p	CLIP-seq
MIRT2611778	hsa-miR-3607-5p	CLIP-seq
MIRT2611779	hsa-miR-3614-5p	CLIP-seq
MIRT1306548	hsa-miR-3668	CLIP-seq
MIRT2315487	hsa-miR-3678-3p	CLIP-seq
MIRT2090840	hsa-miR-3679-3p	CLIP-seq
MIRT2090841	hsa-miR-3682-5p	CLIP-seq
MIRT2090842	hsa-miR-3686	CLIP-seq
MIRT2611780	hsa-miR-3714	CLIP-seq
MIRT2611781	hsa-miR-371b-5p	CLIP-seq
MIRT2611782	hsa-miR-374a	CLIP-seq
MIRT2611783	hsa-miR-374b	CLIP-seq
MIRT2439907	hsa-miR-377	CLIP-seq
MIRT2611784	hsa-miR-382	CLIP-seq
MIRT2611785	hsa-miR-3910	CLIP-seq
MIRT2611786	hsa-miR-3940-5p	CLIP-seq
MIRT1306555	hsa-miR-3973	CLIP-seq
MIRT1306557	hsa-miR-3978	CLIP-seq
MIRT2611787	hsa-miR-409-3p	CLIP-seq
MIRT2611788	hsa-miR-410	CLIP-seq
MIRT1306558	hsa-miR-424	CLIP-seq
MIRT2458231	hsa-miR-4251	CLIP-seq
MIRT2611789	hsa-miR-4268	CLIP-seq
MIRT2611790	hsa-miR-4274	CLIP-seq
MIRT2611791	hsa-miR-4275	CLIP-seq
MIRT2090844	hsa-miR-4276	CLIP-seq
MIRT2611792	hsa-miR-4282	CLIP-seq
MIRT2611793	hsa-miR-4301	CLIP-seq
MIRT2611794	hsa-miR-4306	CLIP-seq
MIRT1306561	hsa-miR-4307	CLIP-seq
MIRT2611795	hsa-miR-4318	CLIP-seq
MIRT2458232	hsa-miR-4329	CLIP-seq
MIRT2611796	hsa-miR-4418	CLIP-seq
MIRT2611797	hsa-miR-4427	CLIP-seq
MIRT2611798	hsa-miR-4428	CLIP-seq
MIRT2611799	hsa-miR-4432	CLIP-seq
MIRT2611800	hsa-miR-4446-5p	CLIP-seq
MIRT2393752	hsa-miR-4450	CLIP-seq
MIRT2611801	hsa-miR-4495	CLIP-seq
MIRT2315490	hsa-miR-4496	CLIP-seq
MIRT2315491	hsa-miR-449c	CLIP-seq
MIRT2611802	hsa-miR-4507	CLIP-seq
MIRT2611803	hsa-miR-4509	CLIP-seq
MIRT2611804	hsa-miR-4519	CLIP-seq
MIRT2611805	hsa-miR-452	CLIP-seq
MIRT1306567	hsa-miR-4524	CLIP-seq
MIRT1306569	hsa-miR-4536	CLIP-seq
MIRT2439908	hsa-miR-4639-3p	CLIP-seq
MIRT2315493	hsa-miR-4643	CLIP-seq
MIRT2611806	hsa-miR-4644	CLIP-seq
MIRT2315494	hsa-miR-466	CLIP-seq
MIRT2090850	hsa-miR-4662a-3p	CLIP-seq
MIRT2611807	hsa-miR-4676-3p	CLIP-seq
MIRT2090851	hsa-miR-4677-3p	CLIP-seq
MIRT2611808	hsa-miR-4678	CLIP-seq
MIRT2090852	hsa-miR-4679	CLIP-seq
MIRT2611809	hsa-miR-4680-3p	CLIP-seq
MIRT2611810	hsa-miR-4716-5p	CLIP-seq
MIRT2611811	hsa-miR-4720-3p	CLIP-seq
MIRT1306579	hsa-miR-4723-3p	CLIP-seq
MIRT1306580	hsa-miR-4724-3p	CLIP-seq
MIRT2611812	hsa-miR-4733-5p	CLIP-seq
MIRT2611813	hsa-miR-4738-3p	CLIP-seq
MIRT2611814	hsa-miR-4742-5p	CLIP-seq
MIRT2611815	hsa-miR-4758-3p	CLIP-seq
MIRT1306581	hsa-miR-4766-5p	CLIP-seq
MIRT2315497	hsa-miR-4778-5p	CLIP-seq
MIRT2611816	hsa-miR-4781-3p	CLIP-seq
MIRT2315498	hsa-miR-4789-3p	CLIP-seq
MIRT2611817	hsa-miR-4790-3p	CLIP-seq
MIRT1306585	hsa-miR-4796-3p	CLIP-seq
MIRT2611818	hsa-miR-4804-3p	CLIP-seq
MIRT2611819	hsa-miR-483-3p	CLIP-seq
MIRT2611820	hsa-miR-488	CLIP-seq
MIRT1306587	hsa-miR-489	CLIP-seq
MIRT2393753	hsa-miR-491-5p	CLIP-seq
MIRT2611821	hsa-miR-495	CLIP-seq
MIRT1306589	hsa-miR-497	CLIP-seq
MIRT2611822	hsa-miR-499-5p	CLIP-seq
MIRT1306590	hsa-miR-503	CLIP-seq
MIRT2611823	hsa-miR-508-5p	CLIP-seq
MIRT2611824	hsa-miR-509-3-5p	CLIP-seq
MIRT2611825	hsa-miR-509-5p	CLIP-seq
MIRT2090857	hsa-miR-5096	CLIP-seq
MIRT2458234	hsa-miR-513b	CLIP-seq
MIRT2090859	hsa-miR-513c	CLIP-seq
MIRT2090860	hsa-miR-514b-5p	CLIP-seq
MIRT2315501	hsa-miR-520d-5p	CLIP-seq
MIRT2315502	hsa-miR-524-5p	CLIP-seq
MIRT2090861	hsa-miR-526b	CLIP-seq
MIRT2611826	hsa-miR-543	CLIP-seq
MIRT2315503	hsa-miR-548a-3p	CLIP-seq
MIRT1306593	hsa-miR-548a-5p	CLIP-seq
MIRT1306594	hsa-miR-548ab	CLIP-seq
MIRT1306595	hsa-miR-548ac	CLIP-seq
MIRT1306598	hsa-miR-548ak	CLIP-seq
MIRT2090863	hsa-miR-548an	CLIP-seq
MIRT1306600	hsa-miR-548b-5p	CLIP-seq
MIRT1306601	hsa-miR-548c-5p	CLIP-seq
MIRT1306602	hsa-miR-548d-3p	CLIP-seq
MIRT1306603	hsa-miR-548d-5p	CLIP-seq
MIRT2315506	hsa-miR-548e	CLIP-seq
MIRT2315507	hsa-miR-548f	CLIP-seq
MIRT2611827	hsa-miR-548g	CLIP-seq
MIRT1306604	hsa-miR-548h	CLIP-seq
MIRT1306605	hsa-miR-548i	CLIP-seq
MIRT1306606	hsa-miR-548j	CLIP-seq
MIRT2611828	hsa-miR-548k	CLIP-seq
MIRT2611829	hsa-miR-548l	CLIP-seq
MIRT2611830	hsa-miR-548m	CLIP-seq
MIRT2090865	hsa-miR-548p	CLIP-seq
MIRT2611831	hsa-miR-548t	CLIP-seq
MIRT1306607	hsa-miR-548w	CLIP-seq
MIRT1306609	hsa-miR-548y	CLIP-seq
MIRT1306610	hsa-miR-548z	CLIP-seq
MIRT1306611	hsa-miR-559	CLIP-seq
MIRT2611832	hsa-miR-561	CLIP-seq
MIRT2611833	hsa-miR-562	CLIP-seq
MIRT2458235	hsa-miR-569	CLIP-seq
MIRT1306613	hsa-miR-590-3p	CLIP-seq
MIRT2090867	hsa-miR-607	CLIP-seq
MIRT2611834	hsa-miR-616	CLIP-seq
MIRT2611835	hsa-miR-617	CLIP-seq
MIRT2090868	hsa-miR-630	CLIP-seq
MIRT2393754	hsa-miR-636	CLIP-seq
MIRT1306616	hsa-miR-646	CLIP-seq
MIRT2090869	hsa-miR-659	CLIP-seq
MIRT1306617	hsa-miR-660	CLIP-seq
MIRT2611836	hsa-miR-671-5p	CLIP-seq
MIRT2090871	hsa-miR-802	CLIP-seq
MIRT2611837	hsa-miR-875-3p	CLIP-seq
MIRT1306619	hsa-miR-889	CLIP-seq
MIRT2315512	hsa-miR-944	CLIP-seq
MIRT2458228	hsa-miR-1264	CLIP-seq
MIRT2611753	hsa-miR-1267	CLIP-seq
MIRT1306512	hsa-miR-1273d	CLIP-seq
MIRT2611754	hsa-miR-1273g	CLIP-seq
MIRT2611755	hsa-miR-1278	CLIP-seq
MIRT1306514	hsa-miR-1283	CLIP-seq
MIRT2611756	hsa-miR-1298	CLIP-seq
MIRT2611757	hsa-miR-1299	CLIP-seq
MIRT2611758	hsa-miR-1303	CLIP-seq
MIRT2090824	hsa-miR-132	CLIP-seq
MIRT2611759	hsa-miR-137	CLIP-seq
MIRT2090825	hsa-miR-142-5p	CLIP-seq
MIRT1306521	hsa-miR-155	CLIP-seq
MIRT1306522	hsa-miR-15a	CLIP-seq
MIRT1306523	hsa-miR-15b	CLIP-seq
MIRT1306524	hsa-miR-16	CLIP-seq
MIRT2611761	hsa-miR-1913	CLIP-seq
MIRT2090828	hsa-miR-194	CLIP-seq
MIRT1306527	hsa-miR-195	CLIP-seq
MIRT1306528	hsa-miR-203	CLIP-seq
MIRT2458229	hsa-miR-2053	CLIP-seq
MIRT1306530	hsa-miR-2054	CLIP-seq
MIRT2611763	hsa-miR-2113	CLIP-seq
MIRT2611764	hsa-miR-2116	CLIP-seq
MIRT2611765	hsa-miR-2117	CLIP-seq
MIRT2090830	hsa-miR-212	CLIP-seq
MIRT2393749	hsa-miR-218	CLIP-seq
MIRT2315484	hsa-miR-2467-3p	CLIP-seq
MIRT2315485	hsa-miR-2682	CLIP-seq
MIRT2393750	hsa-miR-299-3p	CLIP-seq
MIRT2439904	hsa-miR-29a	CLIP-seq
MIRT2439905	hsa-miR-29b	CLIP-seq
MIRT2439906	hsa-miR-29c	CLIP-seq
MIRT2090832	hsa-miR-3117-5p	CLIP-seq
MIRT2611766	hsa-miR-3121-3p	CLIP-seq
MIRT2611767	hsa-miR-3133	CLIP-seq
MIRT2611768	hsa-miR-3143	CLIP-seq
MIRT1306535	hsa-miR-3148	CLIP-seq
MIRT2393751	hsa-miR-3151	CLIP-seq
MIRT2611770	hsa-miR-3156-3p	CLIP-seq
MIRT2611771	hsa-miR-3163	CLIP-seq
MIRT1306539	hsa-miR-3183	CLIP-seq
MIRT2611772	hsa-miR-3189-5p	CLIP-seq
MIRT1306540	hsa-miR-3190	CLIP-seq
MIRT2611773	hsa-miR-324-3p	CLIP-seq
MIRT2611774	hsa-miR-326	CLIP-seq
MIRT2611775	hsa-miR-330-5p	CLIP-seq
MIRT2611776	hsa-miR-33a	CLIP-seq
MIRT2611777	hsa-miR-33b	CLIP-seq
MIRT1306542	hsa-miR-3591-3p	CLIP-seq
MIRT1306544	hsa-miR-3607-3p	CLIP-seq
MIRT2611778	hsa-miR-3607-5p	CLIP-seq
MIRT2611779	hsa-miR-3614-5p	CLIP-seq
MIRT1306548	hsa-miR-3668	CLIP-seq
MIRT2315487	hsa-miR-3678-3p	CLIP-seq
MIRT2090841	hsa-miR-3682-5p	CLIP-seq
MIRT2090842	hsa-miR-3686	CLIP-seq
MIRT2611780	hsa-miR-3714	CLIP-seq
MIRT2439907	hsa-miR-377	CLIP-seq
MIRT2611784	hsa-miR-382	CLIP-seq
MIRT2611785	hsa-miR-3910	CLIP-seq
MIRT2611786	hsa-miR-3940-5p	CLIP-seq
MIRT1306557	hsa-miR-3978	CLIP-seq
MIRT2611787	hsa-miR-409-3p	CLIP-seq
MIRT2611788	hsa-miR-410	CLIP-seq
MIRT1306558	hsa-miR-424	CLIP-seq
MIRT2458231	hsa-miR-4251	CLIP-seq
MIRT2611789	hsa-miR-4268	CLIP-seq
MIRT2611790	hsa-miR-4274	CLIP-seq
MIRT2611791	hsa-miR-4275	CLIP-seq
MIRT2090844	hsa-miR-4276	CLIP-seq
MIRT2611792	hsa-miR-4282	CLIP-seq
MIRT2611793	hsa-miR-4301	CLIP-seq
MIRT2611795	hsa-miR-4318	CLIP-seq
MIRT2458232	hsa-miR-4329	CLIP-seq
MIRT2611797	hsa-miR-4427	CLIP-seq
MIRT2611798	hsa-miR-4428	CLIP-seq
MIRT2611799	hsa-miR-4432	CLIP-seq
MIRT2393752	hsa-miR-4450	CLIP-seq
MIRT2611801	hsa-miR-4495	CLIP-seq
MIRT2315490	hsa-miR-4496	CLIP-seq
MIRT2315491	hsa-miR-449c	CLIP-seq
MIRT2611802	hsa-miR-4507	CLIP-seq
MIRT2611803	hsa-miR-4509	CLIP-seq
MIRT2611804	hsa-miR-4519	CLIP-seq
MIRT2611805	hsa-miR-452	CLIP-seq
MIRT1306567	hsa-miR-4524	CLIP-seq
MIRT1306569	hsa-miR-4536	CLIP-seq
MIRT2439908	hsa-miR-4639-3p	CLIP-seq
MIRT2315493	hsa-miR-4643	CLIP-seq
MIRT2315494	hsa-miR-466	CLIP-seq
MIRT2090850	hsa-miR-4662a-3p	CLIP-seq
MIRT2611807	hsa-miR-4676-3p	CLIP-seq
MIRT2611808	hsa-miR-4678	CLIP-seq
MIRT2611809	hsa-miR-4680-3p	CLIP-seq
MIRT2611811	hsa-miR-4720-3p	CLIP-seq
MIRT1306579	hsa-miR-4723-3p	CLIP-seq
MIRT2611812	hsa-miR-4733-5p	CLIP-seq
MIRT2611813	hsa-miR-4738-3p	CLIP-seq
MIRT2611814	hsa-miR-4742-5p	CLIP-seq
MIRT2611815	hsa-miR-4758-3p	CLIP-seq
MIRT1306581	hsa-miR-4766-5p	CLIP-seq
MIRT2611816	hsa-miR-4781-3p	CLIP-seq
MIRT2315498	hsa-miR-4789-3p	CLIP-seq
MIRT2611817	hsa-miR-4790-3p	CLIP-seq
MIRT1306584	hsa-miR-4795-3p	CLIP-seq
MIRT1306585	hsa-miR-4796-3p	CLIP-seq
MIRT2611818	hsa-miR-4804-3p	CLIP-seq
MIRT2611819	hsa-miR-483-3p	CLIP-seq
MIRT1306587	hsa-miR-489	CLIP-seq
MIRT2393753	hsa-miR-491-5p	CLIP-seq
MIRT2611821	hsa-miR-495	CLIP-seq
MIRT1306589	hsa-miR-497	CLIP-seq
MIRT2611822	hsa-miR-499-5p	CLIP-seq
MIRT1306590	hsa-miR-503	CLIP-seq
MIRT2090857	hsa-miR-5096	CLIP-seq
MIRT2315501	hsa-miR-520d-5p	CLIP-seq
MIRT2315502	hsa-miR-524-5p	CLIP-seq
MIRT2090861	hsa-miR-526b	CLIP-seq
MIRT2611826	hsa-miR-543	CLIP-seq
MIRT2315503	hsa-miR-548a-3p	CLIP-seq
MIRT1306593	hsa-miR-548a-5p	CLIP-seq
MIRT1306594	hsa-miR-548ab	CLIP-seq
MIRT1306595	hsa-miR-548ac	CLIP-seq
MIRT1306598	hsa-miR-548ak	CLIP-seq
MIRT2090863	hsa-miR-548an	CLIP-seq
MIRT1306600	hsa-miR-548b-5p	CLIP-seq
MIRT1306601	hsa-miR-548c-5p	CLIP-seq
MIRT1306602	hsa-miR-548d-3p	CLIP-seq
MIRT1306603	hsa-miR-548d-5p	CLIP-seq
MIRT2315506	hsa-miR-548e	CLIP-seq
MIRT2315507	hsa-miR-548f	CLIP-seq
MIRT2611827	hsa-miR-548g	CLIP-seq
MIRT1306604	hsa-miR-548h	CLIP-seq
MIRT1306605	hsa-miR-548i	CLIP-seq
MIRT1306606	hsa-miR-548j	CLIP-seq
MIRT2611828	hsa-miR-548k	CLIP-seq
MIRT2611829	hsa-miR-548l	CLIP-seq
MIRT2090865	hsa-miR-548p	CLIP-seq
MIRT2611831	hsa-miR-548t	CLIP-seq
MIRT1306607	hsa-miR-548w	CLIP-seq
MIRT1306609	hsa-miR-548y	CLIP-seq
MIRT1306610	hsa-miR-548z	CLIP-seq
MIRT1306611	hsa-miR-559	CLIP-seq
MIRT2611832	hsa-miR-561	CLIP-seq
MIRT2611833	hsa-miR-562	CLIP-seq
MIRT2458235	hsa-miR-569	CLIP-seq
MIRT1306613	hsa-miR-590-3p	CLIP-seq
MIRT2090867	hsa-miR-607	CLIP-seq
MIRT2611834	hsa-miR-616	CLIP-seq
MIRT2611835	hsa-miR-617	CLIP-seq
MIRT2090868	hsa-miR-630	CLIP-seq
MIRT2393754	hsa-miR-636	CLIP-seq
MIRT1306616	hsa-miR-646	CLIP-seq
MIRT2090869	hsa-miR-659	CLIP-seq
MIRT1306617	hsa-miR-660	CLIP-seq
MIRT2611836	hsa-miR-671-5p	CLIP-seq
MIRT2090871	hsa-miR-802	CLIP-seq
MIRT2611837	hsa-miR-875-3p	CLIP-seq
MIRT1306619	hsa-miR-889	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0005515	Function	Protein binding	IPI	15467718, 15778465, 17461779, 17565979, 18339839, 18566587, 19446321, 19720745, 19875983, 19935711, 21045808, 21339740, 21376236, 21964062, 22307628, 23263282, 23953116, 24036451, 24375676, 25241761, 25897075, 27043084, 28514442, 29567957, 30232230, 32647003, 33378666, 33961781, 352
GO:0005524	Function	ATP binding	IDA	33158864
GO:0005524	Function	ATP binding	IEA
GO:0005764	Component	Lysosome	IDA	31130364
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	21867682
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IC	16221682
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	21867682
GO:0005886	Component	Plasma membrane	IEA
GO:0007010	Process	Cytoskeleton organization	NAS	15268862
GO:0008270	Function	Zinc ion binding	IDA	33158864
GO:0008610	Process	Lipid biosynthetic process	IEA
GO:0008610	Process	Lipid biosynthetic process	ISS
GO:0009792	Process	Embryo development ending in birth or egg hatching	IEA
GO:0009792	Process	Embryo development ending in birth or egg hatching	ISS
GO:0010468	Process	Regulation of gene expression	IEA
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IPI	21177249, 25897075
GO:0030036	Process	Actin cytoskeleton organization	IMP	15268862
GO:0030307	Process	Positive regulation of cell growth	NAS	22500797
GO:0030335	Process	Positive regulation of cell migration	IMP	21177249
GO:0030838	Process	Positive regulation of actin filament polymerization	IEA
GO:0031669	Process	Cellular response to nutrient levels	NAS	22500797
GO:0031929	Process	TOR signaling	IEA
GO:0031932	Component	TORC2 complex	IBA
GO:0031932	Component	TORC2 complex	IDA	15268862, 15467718, 21177249, 21343617, 21376236, 21867682, 22084251, 24036451, 29424687, 29567957, 33158864, 35926713
GO:0031932	Component	TORC2 complex	IEA
GO:0031932	Component	TORC2 complex	IPI	17461779
GO:0032008	Process	Positive regulation of TOR signaling	IMP	15467718
GO:0032956	Process	Regulation of actin cytoskeleton organization	IMP	15467718
GO:0038203	Process	TORC2 signaling	IBA
GO:0038203	Process	TORC2 signaling	IDA	16221682, 21177249, 21343617, 21376236, 22084251, 29424687, 29567957, 31130364, 33158864, 35926713
GO:0038203	Process	TORC2 signaling	IEA
GO:0043022	Function	Ribosome binding	IDA	21376236
GO:0043022	Function	Ribosome binding	IEA
GO:0043066	Process	Negative regulation of apoptotic process	NAS	22500797
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	28147277
GO:0043539	Function	Protein serine/threonine kinase activator activity	IBA
GO:0043539	Function	Protein serine/threonine kinase activator activity	IDA	16221682
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0051896	Process	Regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	15718470
GO:0051896	Process	Regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IBA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	9094314
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	21343617, 22084251
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0060090	Function	Molecular adaptor activity	IDA	29567957
GO:0140767	Function	Enzyme-substrate adaptor activity	IDA	21343617
GO:0140896	Process	CGAS/STING signaling pathway	IDA	32911482
GO:0160049	Process	Negative regulation of cGAS/STING signaling pathway	IDA	12172553
GO:1902554	Component	Serine/threonine protein kinase complex	IDA	35926713
GO:2000114	Process	Regulation of establishment of cell polarity	IEA

Other IDs

• MIM: 609022
• HGNC: 28611
• e!Ensembl: ENSG00000164327

Protein

• UniProt ID: Q6R327
• Protein name: Rapamycin-insensitive companion of mTOR (AVO3 homolog) (hAVO3)
• Protein function: Component of the mechanistic target of rapamycin complex 2 (mTORC2), which transduces signals from growth factors to pathways involved in proliferation, cytoskeletal organization, lipogenesis and anabolic output (PubMed:15268862, PubMed:15718470
• PDB: 5ZCS, 6ZWM, 6ZWO, 7PE7, 7PE8, 7PE9, 7TZO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14664	RICTOR_N	57 → 439	Rapamycin-insensitive companion of mTOR, N-term	Domain
  PF14666	RICTOR_M	637 → 740	Rapamycin-insensitive companion of mTOR, middle domain	Domain
  PF14663	RasGEF_N_2	746 → 853	Rapamycin-insensitive companion of mTOR RasGEF_N domain	Domain
  PF14668	RICTOR_V	921 → 991	Rapamycin-insensitive companion of mTOR, domain 5	Domain
  PF14665	RICTOR_phospho	1084 → 1188	Rapamycin-insensitive companion of mTOR, phosphorylation-site	Domain

• Sequence:

  MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGVSNMRKLGHL
  NNFTKLLCDIGHSEEKLGFHYEDIIICLRLALLNEAKEVRAAGLRALRYLIQDSSILQKV
  LKLKVDYLIARCIDIQQSNEVERTQALRLVRKMITVNASLFPSSVTNSLIAVGNDGLQER
  DRMVRACIAIICELALQNPEVVALRGGLNTILKNVIDCQLSRINEALITTILHLLNHPKT
  RQYVRADVELERILAPYTDFHYRHSPDTAEGQLKEDREARFLASKMGIIATFRSWAGIIN
  LCKPGNSGIQSLIGVLCIPNMEIRRGLLEVLYDIFRLPLPVVTEEFIEALLSVDPGRFQD
  SWRLSDGFVAAEAKTILPHRARSRPDLMDNYLALILSAFIRNGLLEGLVEVITNSDDHIS
  VRATILLGELLHMANTILPHSHSHHLHCLPTLMNMAASFDIPKEKRLRASAALNCLKRFH
  EMKKRGPKPYSLHLDHIIQKAIATHQKRDQYLRVQKDIFILKDTEEALLINLRDSQVLQH
  KENLEWNWNLIGTILKWPNVNLRNYKDEQLHRFVRRLLYFYKPSSKLYANLDLDFAKAKQ
  LTVVGCQFTEFLLESEEDGQGYLEDLVKDIVQWLNASSGMKPERSLQNNGLLTTLSQHYF
  LFIGTLSCHPHGVKMLEKCSVFQCLLNLCSLKNQDHLLKLTVSSLDYSRDGLARVILSKI
  LTAATDACRLYATKHLRVLLRANVEFFNNWGIELLVTQLHDKNKTISSEALDILDEACED
  KANLHALIQMKPALSHLGDKGLLLLLRFLSIPKGFSYLNERGYVAKQLEKWHREYNSKYV
  DLIEEQLNEALTTYRKPVDGDNYVRRSNQRLQRPHVYLPIHLYGQLVHHKTGCHLLEVQN
  IITELCRNVRTPDLDKWEEIKKLKASLWALGNIGSSNWGLNLLQEENVIPDILKLAKQCE
  VLSIRGTCVYVLGLIAKTKQGCDILKCHNWDAVRHSRKHLWPVVPDDVEQLCNELSSIPS
  TLSLNSESTSSRHNSESESVPSSMFILEDDRFGSSSTSTFFLDINEDTEPTFYDRSGPIK
  DKNSFPFFASSKLVKNRILNSLTLPNKKHRSSSDPKGGKLSSESKTSNRRIRTLTEPSVD
  FNHSDDFTPISTVQKTLQLETSFMGNKHIEDTGSTPSIGENDLKFTKNFGTENHRENTSR
  ERLVVESSTSSHMKIRSQSFNTDTTTSGISSMSSSPSRETVGVDATTMDTDCGSMSTVVS
  TKTIKTSHYLTPQSNHLSLSKSNSVSLVPPGSSHTLPRRAQSLKAPSIATIKSLADCNFS
  YTSSRDAFGYATLKRLQQQRMHPSLSHSEALASPAKDVLFTDTITMKANSFESRLTPSRF
  MKALSYASLDKEDLLSPINQNTLQRSSSVRSMVSSATYGGSDDYIGLALPVDINDIFQVK
  DIPYFQTKNIPPHDDRGARAFAHDAGGLPSGTGGLVKNSFHLLRQQMSLTEIMNSIHSDA
  SLFLESTEDTGLQEHTDDNCLYCVCIEILGFQPSNQLSAICSHSDFQDIPYSDWCEQTIH
  NPLEVVPSKFSGISGCSDGVSQEGSASSTKSTELLLGVKTIPDDTPMCRILLRKEVLRLV
  INLSSSVSTKCHETGLLTIKEKYPQTFDDICLYSEVSHLLSHCTFRLPCRRFIQELFQDV
  QFLQMHEEAEAVLATPPKQPIVDTSAES

• Sequence length: 1708

Pathways

KEGG:

mTOR signaling pathway

Reactome:

PIP3 activates AKT signaling
CD28 dependent PI3K/Akt signaling
VEGFR2 mediated vascular permeability
Constitutive Signaling by AKT1 E17K in Cancer
Regulation of TP53 Degradation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Premature ovarian failure	Likely pathogenic	rs1329438711	RCV001270199	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GILLES DE LA TOURETTE SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN FAILURE, PREMATURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	12937133		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of duodenum	Adenocarcinoma Of Duodenum	BEFREE	30139386		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26370156		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	25666752		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	23212916		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28445935		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	27789731		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	27789731	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25283550, 26336805		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24479521, 26336805, 27184734, 40403210	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27525949	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24312415, 33061800, 35187863	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	26981779	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26370156, 27676404, 28028034		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	28445935	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26500094, 37298315	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	28028034	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	23212916		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	38186315	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	29882195, 37372460	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29113267, 31469189		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21430067, 22285861, 24244675, 28028034, 38186315	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30580821		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26500094		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31299387		★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic small round cell tumor	Pubtator	23922674	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28132115		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	24966915	Associate	★☆☆☆☆ Found in Text Mining only
Fibromyxosarcoma	Fibromyxosarcoma	BEFREE	27577794		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	24508317	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	20116405, 38186315	Associate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	25907832	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27789731		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	27789731	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	18089801		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	25761241, 27789731, 31187466	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	30580821		★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	27789731	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	28445935	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	25016284	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	22080063		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	22080063	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18929564, 31062368		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28028034	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CGI_DG			★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24966915	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	25907832, 31361614		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25283550, 26336805		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28132115		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	20116405		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26370156, 27676404, 28028034		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28445935		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12937133, 28030804, 31109736		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28028034		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26370156, 27577794, 28132115, 29455662, 30404068		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	23212916		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	26356562, 26923591, 28132115, 30404068		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	28699701, 38615585	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	20839315	Associate	★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	29755672		★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	CLINVAR_DG	11042116, 15284851, 16962829, 17141160, 19344873, 2006, 22500797, 22521878, 23049074, 25348405, 8751724		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	29755672		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	37499483	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	27525949	Inhibit	★☆☆☆☆ Found in Text Mining only
Neonatal Alloimmune Thrombocytopenia	Alloimmune Thrombocytopenia	BEFREE	1932744		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18929564, 23898069, 27577794, 28028034, 28445935, 29358172, 30404068, 31393061, 31740232		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27676404, 30338041		★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	27789731	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	31492082		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24086535, 27211906, 34126157	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28445935		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28445935		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	28445935	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12937133, 28030804, 31109736		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23272152, 23646189, 24244675, 31995655, 36388085	Associate	★☆☆☆☆ Found in Text Mining only
prostatitis	Prostatitis	BEFREE	29278276		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26500094		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	22080063		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	28028034	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	27863413, 31454632		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	24978188, 27863413, 32584426, 38233864, 38237798	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28132115		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31393061, 37372460	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33482765	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31393061		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28028034		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	28028034	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28028034, 32588907	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia Neonatal Alloimmune	Thrombocytopenia	Pubtator	1932744	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	25749387	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29358172, 29790419		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24312263	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25945419	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27525949	Inhibit	★☆☆☆☆ Found in Text Mining only