Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2530
Gene name	Fucosyltransferase 8
Gene symbol	FUT8
Synonyms (NCBI Gene)	CDGFCDGF1
Chromosome	14
Chromosome location	14q23.3
Summary	This gene encodes an enzyme belonging to the family of fucosyltransferases. The product of this gene catalyzes the transfer of fucose from GDP-fucose to N-linked type complex glycopeptides. This enzyme is distinct from other fucosyltransferases which cata

Show/Hide all (4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1297536872	C>G,T	Pathogenic	Missense variant, intron variant, coding sequence variant
rs1334593208	C>T	Pathogenic	Stop gained, coding sequence variant, intron variant
rs1460811017	C>T	Pathogenic	Non coding transcript variant, coding sequence variant, stop gained
rs1555388034	G>T	Pathogenic	Intron variant

215

Show/Hide all (215)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029006	hsa-miR-26b-5p	Microarray	19088304
MIRT438734	hsa-miR-122-5p	Luciferase reporter assayqRT-PCRWestern blot	24130780
MIRT438733	hsa-miR-34a-5p	Luciferase reporter assayqRT-PCRWestern blot	24130780
MIRT438734	hsa-miR-122-5p	Luciferase reporter assayqRT-PCRWestern blot	24130780
MIRT438733	hsa-miR-34a-5p	Luciferase reporter assayqRT-PCRWestern blot	24130780
MIRT438733	hsa-miR-34a-5p	FlowImmunofluorescenceImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	27533464
MIRT438733	hsa-miR-34a-5p	FlowImmunofluorescenceImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	27533464
MIRT735586	hsa-miR-570-3p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)	32072011
MIRT1006783	hsa-miR-1264	CLIP-seq
MIRT1006784	hsa-miR-1272	CLIP-seq
MIRT1006785	hsa-miR-133a	CLIP-seq
MIRT1006786	hsa-miR-133b	CLIP-seq
MIRT1006787	hsa-miR-139-5p	CLIP-seq
MIRT1006788	hsa-miR-142-5p	CLIP-seq
MIRT1006789	hsa-miR-1827	CLIP-seq
MIRT1006790	hsa-miR-183	CLIP-seq
MIRT1006791	hsa-miR-1911	CLIP-seq
MIRT1006792	hsa-miR-198	CLIP-seq
MIRT1006793	hsa-miR-203	CLIP-seq
MIRT1006794	hsa-miR-3115	CLIP-seq
MIRT1006795	hsa-miR-3123	CLIP-seq
MIRT1006796	hsa-miR-3137	CLIP-seq
MIRT1006797	hsa-miR-3144-5p	CLIP-seq
MIRT1006798	hsa-miR-3148	CLIP-seq
MIRT1006799	hsa-miR-3171	CLIP-seq
MIRT1006800	hsa-miR-3191	CLIP-seq
MIRT1006801	hsa-miR-323-3p	CLIP-seq
MIRT1006802	hsa-miR-338-5p	CLIP-seq
MIRT1006803	hsa-miR-340	CLIP-seq
MIRT1006804	hsa-miR-342-3p	CLIP-seq
MIRT1006805	hsa-miR-34a	CLIP-seq
MIRT1006806	hsa-miR-34c-5p	CLIP-seq
MIRT1006807	hsa-miR-3545-3p	CLIP-seq
MIRT1006808	hsa-miR-3612	CLIP-seq
MIRT1006809	hsa-miR-3622a-5p	CLIP-seq
MIRT1006810	hsa-miR-3675-5p	CLIP-seq
MIRT1006811	hsa-miR-377	CLIP-seq
MIRT1006812	hsa-miR-3941	CLIP-seq
MIRT1006813	hsa-miR-3973	CLIP-seq
MIRT1006814	hsa-miR-412	CLIP-seq
MIRT1006815	hsa-miR-4266	CLIP-seq
MIRT1006816	hsa-miR-4307	CLIP-seq
MIRT1006817	hsa-miR-4311	CLIP-seq
MIRT1006818	hsa-miR-4330	CLIP-seq
MIRT1006819	hsa-miR-4423-3p	CLIP-seq
MIRT1006820	hsa-miR-4477a	CLIP-seq
MIRT1006821	hsa-miR-449a	CLIP-seq
MIRT1006822	hsa-miR-449b	CLIP-seq
MIRT1006823	hsa-miR-4501	CLIP-seq
MIRT1006824	hsa-miR-4502	CLIP-seq
MIRT1006825	hsa-miR-4650-5p	CLIP-seq
MIRT1006826	hsa-miR-4652-5p	CLIP-seq
MIRT1006827	hsa-miR-466	CLIP-seq
MIRT1006828	hsa-miR-4672	CLIP-seq
MIRT1006829	hsa-miR-4682	CLIP-seq
MIRT1006830	hsa-miR-4688	CLIP-seq
MIRT1006831	hsa-miR-4695-5p	CLIP-seq
MIRT1006832	hsa-miR-4716-5p	CLIP-seq
MIRT1006833	hsa-miR-4724-5p	CLIP-seq
MIRT1006834	hsa-miR-4731-3p	CLIP-seq
MIRT1006835	hsa-miR-4757-5p	CLIP-seq
MIRT1006836	hsa-miR-4762-3p	CLIP-seq
MIRT1006837	hsa-miR-4766-5p	CLIP-seq
MIRT1006838	hsa-miR-4779	CLIP-seq
MIRT1006839	hsa-miR-4801	CLIP-seq
MIRT1006840	hsa-miR-488	CLIP-seq
MIRT1006841	hsa-miR-494	CLIP-seq
MIRT1006842	hsa-miR-511	CLIP-seq
MIRT1006843	hsa-miR-513c	CLIP-seq
MIRT1006844	hsa-miR-514b-5p	CLIP-seq
MIRT1006845	hsa-miR-522	CLIP-seq
MIRT1006846	hsa-miR-570	CLIP-seq
MIRT1006847	hsa-miR-582-5p	CLIP-seq
MIRT1006848	hsa-miR-597	CLIP-seq
MIRT1006849	hsa-miR-630	CLIP-seq
MIRT1006850	hsa-miR-647	CLIP-seq
MIRT1006851	hsa-miR-649	CLIP-seq
MIRT1006852	hsa-miR-650	CLIP-seq
MIRT1006853	hsa-miR-668	CLIP-seq
MIRT1006854	hsa-miR-767-5p	CLIP-seq
MIRT1006855	hsa-miR-940	CLIP-seq
MIRT1006856	hsa-miR-942	CLIP-seq
MIRT1006857	hsa-miR-185	CLIP-seq
MIRT1006858	hsa-miR-4306	CLIP-seq
MIRT1006859	hsa-miR-4644	CLIP-seq
MIRT1006860	hsa-miR-4693-3p	CLIP-seq
MIRT1006836	hsa-miR-4762-3p	CLIP-seq
MIRT1998294	hsa-miR-1183	CLIP-seq
MIRT1998295	hsa-miR-1233	CLIP-seq
MIRT1998296	hsa-miR-1256	CLIP-seq
MIRT1006784	hsa-miR-1272	CLIP-seq
MIRT1006787	hsa-miR-139-5p	CLIP-seq
MIRT1006790	hsa-miR-183	CLIP-seq
MIRT1998297	hsa-miR-186	CLIP-seq
MIRT1006793	hsa-miR-203	CLIP-seq
MIRT1998298	hsa-miR-223	CLIP-seq
MIRT1006794	hsa-miR-3115	CLIP-seq
MIRT1998299	hsa-miR-3117-5p	CLIP-seq
MIRT1998300	hsa-miR-3122	CLIP-seq
MIRT1998301	hsa-miR-3130-3p	CLIP-seq
MIRT1006797	hsa-miR-3144-5p	CLIP-seq
MIRT1006799	hsa-miR-3171	CLIP-seq
MIRT1998302	hsa-miR-3173-3p	CLIP-seq
MIRT1998303	hsa-miR-3188	CLIP-seq
MIRT1006800	hsa-miR-3191	CLIP-seq
MIRT1998304	hsa-miR-323-5p	CLIP-seq
MIRT1006802	hsa-miR-338-5p	CLIP-seq
MIRT1006805	hsa-miR-34a	CLIP-seq
MIRT1006806	hsa-miR-34c-5p	CLIP-seq
MIRT1006807	hsa-miR-3545-3p	CLIP-seq
MIRT1006810	hsa-miR-3675-5p	CLIP-seq
MIRT1998305	hsa-miR-3689a-3p	CLIP-seq
MIRT1998306	hsa-miR-3689c	CLIP-seq
MIRT1998307	hsa-miR-383	CLIP-seq
MIRT1998308	hsa-miR-3913-5p	CLIP-seq
MIRT1006812	hsa-miR-3941	CLIP-seq
MIRT1006813	hsa-miR-3973	CLIP-seq
MIRT1998309	hsa-miR-410	CLIP-seq
MIRT1006814	hsa-miR-412	CLIP-seq
MIRT1998310	hsa-miR-4277	CLIP-seq
MIRT1998311	hsa-miR-4282	CLIP-seq
MIRT1998312	hsa-miR-4428	CLIP-seq
MIRT1998313	hsa-miR-4452	CLIP-seq
MIRT1998314	hsa-miR-4476	CLIP-seq
MIRT1006820	hsa-miR-4477a	CLIP-seq
MIRT1006821	hsa-miR-449a	CLIP-seq
MIRT1006822	hsa-miR-449b	CLIP-seq
MIRT1006824	hsa-miR-4502	CLIP-seq
MIRT1006826	hsa-miR-4652-5p	CLIP-seq
MIRT1998315	hsa-miR-4653-3p	CLIP-seq
MIRT1006827	hsa-miR-466	CLIP-seq
MIRT1998316	hsa-miR-4670-3p	CLIP-seq
MIRT1006828	hsa-miR-4672	CLIP-seq
MIRT1998317	hsa-miR-4687-5p	CLIP-seq
MIRT1998318	hsa-miR-4697-3p	CLIP-seq
MIRT1998319	hsa-miR-4698	CLIP-seq
MIRT1998320	hsa-miR-4728-5p	CLIP-seq
MIRT1006834	hsa-miR-4731-3p	CLIP-seq
MIRT1006836	hsa-miR-4762-3p	CLIP-seq
MIRT1998321	hsa-miR-4775	CLIP-seq
MIRT1998322	hsa-miR-4793-3p	CLIP-seq
MIRT1006839	hsa-miR-4801	CLIP-seq
MIRT1006841	hsa-miR-494	CLIP-seq
MIRT1006842	hsa-miR-511	CLIP-seq
MIRT1006843	hsa-miR-513c	CLIP-seq
MIRT1006844	hsa-miR-514b-5p	CLIP-seq
MIRT1006845	hsa-miR-522	CLIP-seq
MIRT1998323	hsa-miR-539	CLIP-seq
MIRT1998324	hsa-miR-544	CLIP-seq
MIRT1998325	hsa-miR-548aa	CLIP-seq
MIRT1998326	hsa-miR-548ac	CLIP-seq
MIRT1998327	hsa-miR-548d-3p	CLIP-seq
MIRT1998328	hsa-miR-548z	CLIP-seq
MIRT1998329	hsa-miR-580	CLIP-seq
MIRT1006847	hsa-miR-582-5p	CLIP-seq
MIRT1998330	hsa-miR-592	CLIP-seq
MIRT1006848	hsa-miR-597	CLIP-seq
MIRT1006849	hsa-miR-630	CLIP-seq
MIRT1006850	hsa-miR-647	CLIP-seq
MIRT1998331	hsa-miR-654-3p	CLIP-seq
MIRT1006853	hsa-miR-668	CLIP-seq
MIRT1998332	hsa-miR-759	CLIP-seq
MIRT1998333	hsa-miR-876-3p	CLIP-seq
MIRT1998334	hsa-miR-9	CLIP-seq
MIRT1006856	hsa-miR-942	CLIP-seq
MIRT1006799	hsa-miR-3171	CLIP-seq
MIRT1006836	hsa-miR-4762-3p	CLIP-seq
MIRT1006849	hsa-miR-630	CLIP-seq
MIRT1006811	hsa-miR-377	CLIP-seq
MIRT1998294	hsa-miR-1183	CLIP-seq
MIRT1006789	hsa-miR-1827	CLIP-seq
MIRT2388263	hsa-miR-221	CLIP-seq
MIRT2388264	hsa-miR-222	CLIP-seq
MIRT1998299	hsa-miR-3117-5p	CLIP-seq
MIRT1998300	hsa-miR-3122	CLIP-seq
MIRT1006796	hsa-miR-3137	CLIP-seq
MIRT1998303	hsa-miR-3188	CLIP-seq
MIRT1006808	hsa-miR-3612	CLIP-seq
MIRT1998305	hsa-miR-3689a-3p	CLIP-seq
MIRT1998306	hsa-miR-3689c	CLIP-seq
MIRT1998308	hsa-miR-3913-5p	CLIP-seq
MIRT1006815	hsa-miR-4266	CLIP-seq
MIRT1998314	hsa-miR-4476	CLIP-seq
MIRT1998316	hsa-miR-4670-3p	CLIP-seq
MIRT1006831	hsa-miR-4695-5p	CLIP-seq
MIRT1998320	hsa-miR-4728-5p	CLIP-seq
MIRT1006835	hsa-miR-4757-5p	CLIP-seq
MIRT1998321	hsa-miR-4775	CLIP-seq
MIRT1006838	hsa-miR-4779	CLIP-seq
MIRT1006852	hsa-miR-650	CLIP-seq
MIRT1998334	hsa-miR-9	CLIP-seq
MIRT1006855	hsa-miR-940	CLIP-seq
MIRT1006790	hsa-miR-183	CLIP-seq
MIRT1006802	hsa-miR-338-5p	CLIP-seq
MIRT1006805	hsa-miR-34a	CLIP-seq
MIRT1006806	hsa-miR-34c-5p	CLIP-seq
MIRT1006812	hsa-miR-3941	CLIP-seq
MIRT1006813	hsa-miR-3973	CLIP-seq
MIRT1006821	hsa-miR-449a	CLIP-seq
MIRT1006822	hsa-miR-449b	CLIP-seq
MIRT1006827	hsa-miR-466	CLIP-seq
MIRT1006828	hsa-miR-4672	CLIP-seq
MIRT1006830	hsa-miR-4688	CLIP-seq
MIRT1998319	hsa-miR-4698	CLIP-seq
MIRT1006834	hsa-miR-4731-3p	CLIP-seq
MIRT1006839	hsa-miR-4801	CLIP-seq
MIRT1006840	hsa-miR-488	CLIP-seq
MIRT1006846	hsa-miR-570	CLIP-seq
MIRT1998330	hsa-miR-592	CLIP-seq
MIRT1006848	hsa-miR-597	CLIP-seq
MIRT1006851	hsa-miR-649	CLIP-seq
MIRT1998331	hsa-miR-654-3p	CLIP-seq
MIRT1006853	hsa-miR-668	CLIP-seq
MIRT1006833	hsa-miR-4724-5p	CLIP-seq
MIRT2681237	hsa-miR-4761-3p	CLIP-seq

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0001701	Process	In utero embryonic development	NAS	11698403
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	NAS	11698403
GO:0006486	Process	Protein glycosylation	IEA
GO:0006487	Process	Protein N-linked glycosylation	IBA
GO:0006487	Process	Protein N-linked glycosylation	TAS	9133635
GO:0006491	Process	N-glycan processing	IEA
GO:0006491	Process	N-glycan processing	IEA
GO:0006491	Process	N-glycan processing	TAS	11698403
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0007585	Process	Respiratory gaseous exchange by respiratory system	IEA
GO:0008424	Function	Glycoprotein 6-alpha-L-fucosyltransferase activity	IDA	17172260
GO:0008424	Function	Glycoprotein 6-alpha-L-fucosyltransferase activity	IEA
GO:0008424	Function	Glycoprotein 6-alpha-L-fucosyltransferase activity	TAS	9133635, 11698403
GO:0009312	Process	Oligosaccharide biosynthetic process	TAS	9133635
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010761	Process	Fibroblast migration	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0017124	Function	SH3 domain binding	IEA
GO:0018279	Process	Protein N-linked glycosylation via asparagine	IDA	17172260
GO:0019082	Process	Viral protein processing	TAS
GO:0032580	Component	Golgi cisterna membrane	IEA
GO:0036071	Process	N-glycan fucosylation	IBA
GO:0036071	Process	N-glycan fucosylation	IEA
GO:0036071	Process	N-glycan fucosylation	IEA
GO:0042355	Process	L-fucose catabolic process	NAS	11698403
GO:0043112	Process	Receptor metabolic process	IEA
GO:0046368	Process	GDP-L-fucose metabolic process	IDA	17172260
GO:0046921	Function	Alpha-(1->6)-fucosyltransferase activity	IBA
GO:0046921	Function	Alpha-(1->6)-fucosyltransferase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:1900407	Process	Regulation of cellular response to oxidative stress	IEA

MIM	HGNC	e!Ensembl
602589	4019	ENSG00000033170

Q9BYC5

Protein name

Alpha-(1,6)-fucosyltransferase (Alpha1-6FucT) (EC 2.4.1.68) (Fucosyltransferase 8) (GDP-L-Fuc:N-acetyl-beta-D-glucosaminide alpha1,6-fucosyltransferase) (GDP-fucose--glycoprotein fucosyltransferase) (Glycoprotein 6-alpha-L-fucosyltransferase)

Protein function

Catalyzes the addition of fucose in alpha 1-6 linkage to the first GlcNAc residue, next to the peptide chains in N-glycans.

PDB

2DE0 , 6VLD , 6VLE , 6X5H , 6X5R , 6X5S , 6X5T , 6X5U

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14604	SH3_9	509 → 559	Variant SH3 domain	Domain

Sequence

MRPWTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHSSRELSKILAKLERLKQQNEDL
RRMAESLRIPEGPIDQGPAIGRVRVLEEQLVKAKEQIENYKKQTRNGLGKDHEILRRRIE
NGAKELWFFLQSELKKLKNLEGNELQRHADEFLLDLGHHERSIMTDLYYLSQTDGAGDWR
EKEAKDLTELVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQRT
LILESQNWRYATGGWETVFRPVSETCTDRSGISTGHWSGEVKDKNVQVVELPIVDSLHPR
PPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEATKKLGFKHPVI
GVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPSLLKEAKTK
YPNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQ
TLHPDASANFHSLDDIYYFGGQNAHNQIAIYAHQPRTADEIPMEPGDIIGVAGNHWDGYS
KGVNRKLGRTGLYPSYKVREKIETVKYPTYPEAEK

Sequence length

575

Interactions

View interactions

	KEGG		Reactome
	N-Glycan biosynthesis Various types of N-glycan biosynthesis Glycosaminoglycan biosynthesis - keratan sulfate Metabolic pathways Transcriptional misregulation in cancer		Reactions specific to the complex N-glycan synthesis pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Congenital disorder of glycosylation with defective fucosylation 1	Likely pathogenic; Pathogenic	rs371242983, rs1460811017, rs1297536872, rs1555388034, rs1334593208, rs1885915172	RCV002250965 RCV000656448 RCV000656449 RCV000656450 RCV000656451 RCV001261986 View all (1 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
FUT8-related disorder	Likely pathogenic	rs1225111857	RCV003404504	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Malignant tumor of urinary bladder	Pathogenic	rs1460811017	RCV005900404	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA AND RELATED DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (77)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acquired Kyphoscoliosis	Acquired Kyphoscoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	23609441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	26754572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31557675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31557675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases Metabolic Inborn	Brain disease	Pubtator	32049367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28982386, 31306109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23819905, 28982386, 31306109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19302290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24232099, 24927126, 31022917, 35504805	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23267084, 29228607, 29872497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30614075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	32474671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	22732410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23267084, 25174450, 29975776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19302290	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22152070, 29975776, 35955598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CONGENITAL DISORDER OF GLYCOSYLATION WITH DEFECTIVE FUCOSYLATION	Congenital Disorder Of Glycosylation With Defective Fucosylation	GENOMICS_ENGLAND_DG	15917429, 29304374		★★★★★ ★☆☆☆☆ Found in Text Mining only
CONGENITAL DISORDER OF GLYCOSYLATION WITH DEFECTIVE FUCOSYLATION	Congenital Disorder Of Glycosylation With Defective Fucosylation	BEFREE	29304374		★★★★★ ★☆☆☆☆ Found in Text Mining only
CONGENITAL DISORDER OF GLYCOSYLATION WITH DEFECTIVE FUCOSYLATION	Congenital Disorder Of Glycosylation With Defective Fucosylation	UNIPROT_DG	29304374, 30237576		★★★★★ ★☆☆☆☆ Found in Text Mining only
CONGENITAL DISORDER OF GLYCOSYLATION WITH DEFECTIVE FUCOSYLATION	Congenital Disorder Of Glycosylation With Defective Fucosylation	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Disorders of Glycosylation	Congenital disorder of glycosylation	Pubtator	29304374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Disorders of Glycosylation	Congenital disorder of glycosylation	BEFREE	31580894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital kyphoscoliosis	Congenital kyphoscoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	31623829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	37053181	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	30614075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	31580894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma of childhood	Glaucoma	BEFREE	31580894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	36039648	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease XIV	Glycogen storage disease	Pubtator	32049367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	29304374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrophthalmos	Glaucoma, congenital	BEFREE	31580894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrophthalmos	Glaucoma, congenital	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	GENOMICS_ENGLAND_DG	15917429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	30987719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10232614, 10580126, 21503570, 24130780, 24232099, 25873065, 27977808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10232614, 10580126, 21503570, 24130780, 25873065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30101373	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28951630	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28982386, 31306109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23267084, 25572677, 29228607, 29872497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	30987719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24906821, 29339807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21503570, 23267084, 28609653, 31306109		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28609653, 28609658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	28609658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	30987719	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	36849997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	27967290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10232614, 10580126, 23267084, 25873065, 29975776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	29304374, 32049367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23267084, 25572677, 29228607, 31381176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35022380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	29650332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19302290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	38643887	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24906821, 29339807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24906821	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32378902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	17172260, 22011814, 22732410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31669139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	23486519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	29304374, 32049367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	PSYGENET_DG	21471224, 25979332		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	27773385		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia and related disorders	Schizophrenia	BEFREE	21471224		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia and related disorders	Schizophrenia	PSYGENET_DG	21471224		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizures	Seizures	Pubtator	37053181	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24732908	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34799549	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FUT8 (fucosyltransferase 8)