Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	252995
Gene name	Fibronectin type III domain containing 5
Gene symbol	FNDC5
Synonyms (NCBI Gene)	FRCP2irisin
Chromosome	1
Chromosome location	1p35.1
Summary	This gene encodes a secreted protein that is released from muscle cells during exercise. The encoded protein may participate in the development of brown fat. Translation of the precursor protein initiates at a non-AUG start codon at a position that is con

231

Show/Hide all (231)

miRTarBase ID	miRNA	Experiments	Reference
MIRT613054	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT615268	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT623915	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT613053	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT613052	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613051	hsa-miR-3671	HITS-CLIP	23824327
MIRT613050	hsa-miR-607	HITS-CLIP	23824327
MIRT613049	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT613048	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT613047	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT613054	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT615268	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT613053	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT613052	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613051	hsa-miR-3671	HITS-CLIP	23824327
MIRT613050	hsa-miR-607	HITS-CLIP	23824327
MIRT613049	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT613048	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT613047	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT613054	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT613053	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT613052	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613051	hsa-miR-3671	HITS-CLIP	23824327
MIRT613050	hsa-miR-607	HITS-CLIP	23824327
MIRT613049	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT613048	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT613047	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT613054	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT613053	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT613052	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613051	hsa-miR-3671	HITS-CLIP	23824327
MIRT613050	hsa-miR-607	HITS-CLIP	23824327
MIRT613049	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT613048	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT613047	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT613054	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT613053	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT613052	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613051	hsa-miR-3671	HITS-CLIP	23824327
MIRT613050	hsa-miR-607	HITS-CLIP	23824327
MIRT613049	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT613048	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT613047	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT613054	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT615268	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT613053	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT613052	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613051	hsa-miR-3671	HITS-CLIP	23824327
MIRT613050	hsa-miR-607	HITS-CLIP	23824327
MIRT613049	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT613048	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT613047	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT613054	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT615268	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT623915	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT613053	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT613052	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613051	hsa-miR-3671	HITS-CLIP	23824327
MIRT613050	hsa-miR-607	HITS-CLIP	23824327
MIRT613049	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT613048	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT613047	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT613054	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT615268	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT623915	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT613053	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT613052	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613051	hsa-miR-3671	HITS-CLIP	23824327
MIRT613050	hsa-miR-607	HITS-CLIP	23824327
MIRT613049	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT613048	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT613047	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT613054	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT615268	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT613053	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT613052	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613051	hsa-miR-3671	HITS-CLIP	23824327
MIRT613050	hsa-miR-607	HITS-CLIP	23824327
MIRT613049	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT613048	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT613047	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT613054	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT613053	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT613052	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613051	hsa-miR-3671	HITS-CLIP	23824327
MIRT613050	hsa-miR-607	HITS-CLIP	23824327
MIRT613049	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT613048	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT613047	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT732747	hsa-miR-193b-3p	qRT-PCR	34018309
MIRT613054	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT615268	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT623915	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT613053	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT613052	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613051	hsa-miR-3671	HITS-CLIP	23824327
MIRT613050	hsa-miR-607	HITS-CLIP	23824327
MIRT613049	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT613048	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT613047	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT613054	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT615268	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT613053	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT613052	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613051	hsa-miR-3671	HITS-CLIP	23824327
MIRT613050	hsa-miR-607	HITS-CLIP	23824327
MIRT613049	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT613048	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT613047	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT613054	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT613053	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT613052	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613051	hsa-miR-3671	HITS-CLIP	23824327
MIRT613050	hsa-miR-607	HITS-CLIP	23824327
MIRT613049	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT613048	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT613047	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT613054	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT613053	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT613052	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613051	hsa-miR-3671	HITS-CLIP	23824327
MIRT613050	hsa-miR-607	HITS-CLIP	23824327
MIRT613049	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT613048	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT613047	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT613054	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT613053	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT613052	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613051	hsa-miR-3671	HITS-CLIP	23824327
MIRT613050	hsa-miR-607	HITS-CLIP	23824327
MIRT613049	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT613048	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT613047	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT613054	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT615268	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT613053	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT613052	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613051	hsa-miR-3671	HITS-CLIP	23824327
MIRT613050	hsa-miR-607	HITS-CLIP	23824327
MIRT613049	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT613048	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT613047	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT613054	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT615268	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT623915	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT613053	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT613052	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613051	hsa-miR-3671	HITS-CLIP	23824327
MIRT613050	hsa-miR-607	HITS-CLIP	23824327
MIRT613049	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT613048	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT613047	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT613054	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT615268	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT623915	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT613053	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT613052	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613051	hsa-miR-3671	HITS-CLIP	23824327
MIRT613050	hsa-miR-607	HITS-CLIP	23824327
MIRT613049	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT613048	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT613047	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT613054	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT615268	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT613053	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT613052	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613051	hsa-miR-3671	HITS-CLIP	23824327
MIRT613050	hsa-miR-607	HITS-CLIP	23824327
MIRT613049	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT613048	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT613047	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT613054	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT613053	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT613052	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613051	hsa-miR-3671	HITS-CLIP	23824327
MIRT613050	hsa-miR-607	HITS-CLIP	23824327
MIRT613049	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT613048	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT613047	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT756195	hsa-miR-143-3p	Luciferase reporter assayWestern blotting	37815745
MIRT1000586	hsa-miR-150	CLIP-seq
MIRT1000587	hsa-miR-1910	CLIP-seq
MIRT1000588	hsa-miR-1915	CLIP-seq
MIRT1000589	hsa-miR-218	CLIP-seq
MIRT1000590	hsa-miR-3667-5p	CLIP-seq
MIRT1000591	hsa-miR-4685-5p	CLIP-seq
MIRT1000592	hsa-miR-4713-5p	CLIP-seq
MIRT1000593	hsa-miR-4726-3p	CLIP-seq
MIRT1000594	hsa-miR-532-3p	CLIP-seq
MIRT1000595	hsa-miR-636	CLIP-seq
MIRT1000596	hsa-miR-1254	CLIP-seq
MIRT1000597	hsa-miR-1273f	CLIP-seq
MIRT1000598	hsa-miR-15a	CLIP-seq
MIRT1000599	hsa-miR-15b	CLIP-seq
MIRT1000600	hsa-miR-16	CLIP-seq
MIRT1000601	hsa-miR-195	CLIP-seq
MIRT1000602	hsa-miR-214	CLIP-seq
MIRT1000603	hsa-miR-3116	CLIP-seq
MIRT1000604	hsa-miR-3157-5p	CLIP-seq
MIRT1000605	hsa-miR-3158-3p	CLIP-seq
MIRT1000606	hsa-miR-3173-5p	CLIP-seq
MIRT1000607	hsa-miR-3202	CLIP-seq
MIRT1000608	hsa-miR-3616-3p	CLIP-seq
MIRT1000609	hsa-miR-3619-5p	CLIP-seq
MIRT1000610	hsa-miR-3655	CLIP-seq
MIRT1000611	hsa-miR-3921	CLIP-seq
MIRT1000612	hsa-miR-3944-5p	CLIP-seq
MIRT1000613	hsa-miR-3978	CLIP-seq
MIRT1000614	hsa-miR-424	CLIP-seq
MIRT1000615	hsa-miR-4252	CLIP-seq
MIRT1000616	hsa-miR-4261	CLIP-seq
MIRT1000617	hsa-miR-431	CLIP-seq
MIRT1000618	hsa-miR-4420	CLIP-seq
MIRT1000619	hsa-miR-4428	CLIP-seq
MIRT1000620	hsa-miR-4446-3p	CLIP-seq
MIRT1000621	hsa-miR-4476	CLIP-seq
MIRT1000622	hsa-miR-4534	CLIP-seq
MIRT1000623	hsa-miR-4653-5p	CLIP-seq
MIRT1000624	hsa-miR-4675	CLIP-seq
MIRT1000625	hsa-miR-4682	CLIP-seq
MIRT1000626	hsa-miR-4691-3p	CLIP-seq
MIRT1000627	hsa-miR-4721	CLIP-seq
MIRT1000628	hsa-miR-4738-3p	CLIP-seq
MIRT1000629	hsa-miR-4741	CLIP-seq
MIRT1000630	hsa-miR-4764-5p	CLIP-seq
MIRT1000631	hsa-miR-497	CLIP-seq
MIRT1000632	hsa-miR-511	CLIP-seq
MIRT1000633	hsa-miR-624	CLIP-seq
MIRT1000634	hsa-miR-661	CLIP-seq
MIRT1000635	hsa-miR-761	CLIP-seq
MIRT1996502	hsa-miR-4311	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence
GO:0005179	Function	Hormone activity	IEA
GO:0005576	Component	Extracellular region	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	ISS
GO:0005777	Component	Peroxisome	IEA
GO:0005778	Component	Peroxisomal membrane	IEA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0007165	Process	Signal transduction	IEA
GO:0014850	Process	Response to muscle activity	ISS
GO:0016020	Component	Membrane	IEA
GO:0090336	Process	Positive regulation of brown fat cell differentiation	IBA
GO:0090336	Process	Positive regulation of brown fat cell differentiation	ISS

MIM	HGNC	e!Ensembl
611906	20240	ENSG00000160097

Q8NAU1

Protein name

Fibronectin type III domain-containing protein 5 (Fibronectin type III repeat-containing protein 2) [Cleaved into: Irisin]

Protein function

[Irisin]: Mediates beneficial effects of muscular exercise. Induces browning of white adipose tissue by stimulating UCP1 expression, at least in part, via the nuclear receptor PPARA.

PDB

4LSD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00041	fn3	35 → 117	Fibronectin type III domain	Domain
PF16066	DUF4808	149 → 207	Domain of unknown function (DUF4808)	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed, with highest levels in heart. Very low expression, if any, in colon, pancreas and spleen. {ECO:0000269|PubMed:24040023}.

Sequence

MHPGSPSAWPPRARAALRLWLGCVCFALVQADSPSAPVNVTVRHLKANSAVVSWDVLEDE
VVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPV
LFKTPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIK
DNEPNNNKEKTKSASETSTPEHQGGGLLRSKI

Sequence length

212

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARDIOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR DYSFUNCTION, LEFT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (102)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arteriosclerosis	Arteriosclerosis	BEFREE	31191305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	30403705, 35898516, 36689357, 37175880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31191305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35408891, 37239973	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35053200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31976024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	38297313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	31209361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	30403705, 32150081, 35898516	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30611879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	31238319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31238319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	38139046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30246803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34972713, 40313961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	32150081	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crisponi syndrome	Crisponi syndrome	Pubtator	32560375	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	30802460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	28744117	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	36768791	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30611879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	30569156	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	26790404, 28424548, 30323244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30611879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24297848, 31015797, 32964051, 34917685	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24943964, 25369206, 26024756, 26790404, 26968837, 32917052, 36139374, 37335063, 37909533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	29121940	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	23436919, 25369206, 26024756, 26968837, 28479383, 31015797, 31545080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28479383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	26024756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	28424548	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	25025207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	30007970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	30389552	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	30389552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	32001301	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28472477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28472477, 30007970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	29197093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	23001918, 36139374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	26024756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	31191305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	32150081	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	29303830		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	35523819	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29971668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	23637927, 25369206, 31799981, 32001301, 32544194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	25427998, 26968837	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	31238319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	35053200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28012856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	32981307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	31976024	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	32001301	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	36430689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	35408891	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	35370941	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	29522296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27256459, 28012856, 31614634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	29048621, 30323244, 31974460, 34067751, 36599894, 36642213, 37335063	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30611879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	32981307	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	28904307, 29670915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	32964051	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30611879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	28744117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28070911, 31284265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	34369880	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	34369880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	34160912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27256459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28377712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30844383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28472477, 30389552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31614634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	28472477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23436919, 25369206, 26968837, 29374559, 29745314, 30311592, 30794116, 30940158, 31015797, 31055234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23637927, 24398403, 24506871, 25369206, 26968837, 28125733, 28195643, 29121940, 30323244, 31635130, 31974460, 32544194, 32917052, 34574727, 37569456	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	25427998, 26790404, 28904307, 36642213	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	31015797	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	26024756	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	29670915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30550785, 31184223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	29048621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36599894	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30323244	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31412018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29197093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	36750863	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	34907845	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	30802460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	28424548, 28744117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	29522296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29522296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	25025207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	25025207	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sacroiliitis	Sacroiliitis	Pubtator	35898516	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	25025207	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	30952206	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	35898516	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30007970, 30389552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	35010965	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FNDC5 (fibronectin type III domain containing 5)