Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	252969
Gene name	Nei like DNA glycosylase 2
Gene symbol	NEIL2
Synonyms (NCBI Gene)	NEH2NEI2
Chromosome	8
Chromosome location	8p23.1
Summary	This gene encodes a member of the Fpg/Nei family of DNA glycosylases. These glycosylases initiate the first step in base excision repair by cleaving oxidatively damaged bases and introducing a DNA strand break via their abasic site lyase activity. This en

231

Show/Hide all (231)

miRTarBase ID	miRNA	Experiments	Reference
MIRT041564	hsa-miR-193b-3p	CLASH	23622248
MIRT496470	hsa-miR-3160-5p	PAR-CLIP	22291592
MIRT496470	hsa-miR-3160-5p	PAR-CLIP	22291592
MIRT1180033	hsa-miR-193a-3p	CLIP-seq
MIRT1180034	hsa-miR-193b	CLIP-seq
MIRT1180035	hsa-miR-3074-5p	CLIP-seq
MIRT1180036	hsa-miR-3143	CLIP-seq
MIRT1180037	hsa-miR-370	CLIP-seq
MIRT1180038	hsa-miR-421	CLIP-seq
MIRT1180039	hsa-miR-4270	CLIP-seq
MIRT1180040	hsa-miR-4297	CLIP-seq
MIRT1180041	hsa-miR-4441	CLIP-seq
MIRT1180042	hsa-miR-4512	CLIP-seq
MIRT1180043	hsa-miR-4668-3p	CLIP-seq
MIRT1180044	hsa-miR-4685-5p	CLIP-seq
MIRT1180045	hsa-miR-4694-3p	CLIP-seq
MIRT1180046	hsa-miR-4698	CLIP-seq
MIRT1180047	hsa-miR-4764-3p	CLIP-seq
MIRT1180048	hsa-miR-4802-5p	CLIP-seq
MIRT1180049	hsa-miR-4803	CLIP-seq
MIRT1180050	hsa-miR-508-5p	CLIP-seq
MIRT1180051	hsa-miR-548c-3p	CLIP-seq
MIRT1180052	hsa-miR-656	CLIP-seq
MIRT1180053	hsa-miR-892b	CLIP-seq
MIRT1180054	hsa-miR-1200	CLIP-seq
MIRT1180055	hsa-miR-129-3p	CLIP-seq
MIRT1180033	hsa-miR-193a-3p	CLIP-seq
MIRT1180034	hsa-miR-193b	CLIP-seq
MIRT1180056	hsa-miR-219-2-3p	CLIP-seq
MIRT1180057	hsa-miR-2964a-3p	CLIP-seq
MIRT1180058	hsa-miR-3126-5p	CLIP-seq
MIRT1180059	hsa-miR-3140-5p	CLIP-seq
MIRT1180036	hsa-miR-3143	CLIP-seq
MIRT1180060	hsa-miR-3622a-3p	CLIP-seq
MIRT1180061	hsa-miR-3622b-3p	CLIP-seq
MIRT1180037	hsa-miR-370	CLIP-seq
MIRT1180062	hsa-miR-4256	CLIP-seq
MIRT1180063	hsa-miR-4419a	CLIP-seq
MIRT1180064	hsa-miR-4423-5p	CLIP-seq
MIRT1180065	hsa-miR-4510	CLIP-seq
MIRT1180042	hsa-miR-4512	CLIP-seq
MIRT1180066	hsa-miR-4680-3p	CLIP-seq
MIRT1180045	hsa-miR-4694-3p	CLIP-seq
MIRT1180046	hsa-miR-4698	CLIP-seq
MIRT1180067	hsa-miR-4780	CLIP-seq
MIRT1180048	hsa-miR-4802-5p	CLIP-seq
MIRT1180068	hsa-miR-515-5p	CLIP-seq
MIRT1180069	hsa-miR-520d-5p	CLIP-seq
MIRT1180070	hsa-miR-524-5p	CLIP-seq
MIRT1180053	hsa-miR-892b	CLIP-seq
MIRT2052067	hsa-miR-1247	CLIP-seq
MIRT2052068	hsa-miR-1273e	CLIP-seq
MIRT2052069	hsa-miR-1273f	CLIP-seq
MIRT2052070	hsa-miR-1299	CLIP-seq
MIRT2052071	hsa-miR-143	CLIP-seq
MIRT2052072	hsa-miR-183	CLIP-seq
MIRT2052073	hsa-miR-2114	CLIP-seq
MIRT2052074	hsa-miR-214	CLIP-seq
MIRT1180056	hsa-miR-219-2-3p	CLIP-seq
MIRT1180057	hsa-miR-2964a-3p	CLIP-seq
MIRT2052075	hsa-miR-298	CLIP-seq
MIRT2052076	hsa-miR-31	CLIP-seq
MIRT2052077	hsa-miR-3122	CLIP-seq
MIRT2052078	hsa-miR-3128	CLIP-seq
MIRT2052079	hsa-miR-338-3p	CLIP-seq
MIRT2052080	hsa-miR-3612	CLIP-seq
MIRT2052081	hsa-miR-3619-5p	CLIP-seq
MIRT2052082	hsa-miR-3664-5p	CLIP-seq
MIRT2052083	hsa-miR-3667-5p	CLIP-seq
MIRT2052084	hsa-miR-3689a-3p	CLIP-seq
MIRT2052085	hsa-miR-3689c	CLIP-seq
MIRT2052086	hsa-miR-378	CLIP-seq
MIRT2052087	hsa-miR-378b	CLIP-seq
MIRT2052088	hsa-miR-378c	CLIP-seq
MIRT2052089	hsa-miR-378d	CLIP-seq
MIRT2052090	hsa-miR-378e	CLIP-seq
MIRT2052091	hsa-miR-378f	CLIP-seq
MIRT2052092	hsa-miR-378h	CLIP-seq
MIRT2052093	hsa-miR-378i	CLIP-seq
MIRT2052094	hsa-miR-3913-5p	CLIP-seq
MIRT2052095	hsa-miR-3929	CLIP-seq
MIRT2052096	hsa-miR-422a	CLIP-seq
MIRT1180062	hsa-miR-4256	CLIP-seq
MIRT1180039	hsa-miR-4270	CLIP-seq
MIRT1180040	hsa-miR-4297	CLIP-seq
MIRT2052097	hsa-miR-4419b	CLIP-seq
MIRT1180041	hsa-miR-4441	CLIP-seq
MIRT2052098	hsa-miR-4443	CLIP-seq
MIRT2052099	hsa-miR-4459	CLIP-seq
MIRT2052100	hsa-miR-4470	CLIP-seq
MIRT2052101	hsa-miR-4478	CLIP-seq
MIRT2052102	hsa-miR-4530	CLIP-seq
MIRT2052103	hsa-miR-4638-3p	CLIP-seq
MIRT2052104	hsa-miR-4695-5p	CLIP-seq
MIRT2052105	hsa-miR-4696	CLIP-seq
MIRT2052106	hsa-miR-4708-5p	CLIP-seq
MIRT2052107	hsa-miR-4714-5p	CLIP-seq
MIRT2052108	hsa-miR-4722-5p	CLIP-seq
MIRT2052109	hsa-miR-4728-5p	CLIP-seq
MIRT2052110	hsa-miR-4761-5p	CLIP-seq
MIRT2052111	hsa-miR-4770	CLIP-seq
MIRT2052112	hsa-miR-4782-5p	CLIP-seq
MIRT2052113	hsa-miR-4786-5p	CLIP-seq
MIRT2052114	hsa-miR-485-5p	CLIP-seq
MIRT2052115	hsa-miR-516b	CLIP-seq
MIRT2052116	hsa-miR-650	CLIP-seq
MIRT2052117	hsa-miR-711	CLIP-seq
MIRT2052118	hsa-miR-761	CLIP-seq
MIRT2052119	hsa-miR-922	CLIP-seq
MIRT2052067	hsa-miR-1247	CLIP-seq
MIRT2052073	hsa-miR-2114	CLIP-seq
MIRT1180060	hsa-miR-3622a-3p	CLIP-seq
MIRT1180061	hsa-miR-3622b-3p	CLIP-seq
MIRT2579710	hsa-miR-1228	CLIP-seq
MIRT2052067	hsa-miR-1247	CLIP-seq
MIRT2052068	hsa-miR-1273e	CLIP-seq
MIRT2579711	hsa-miR-1298	CLIP-seq
MIRT2052070	hsa-miR-1299	CLIP-seq
MIRT2579712	hsa-miR-1323	CLIP-seq
MIRT2052072	hsa-miR-183	CLIP-seq
MIRT2052073	hsa-miR-2114	CLIP-seq
MIRT2579713	hsa-miR-219-1-3p	CLIP-seq
MIRT2579714	hsa-miR-30a	CLIP-seq
MIRT2579715	hsa-miR-30b	CLIP-seq
MIRT2579716	hsa-miR-30c	CLIP-seq
MIRT2579717	hsa-miR-30d	CLIP-seq
MIRT2579718	hsa-miR-30e	CLIP-seq
MIRT2052076	hsa-miR-31	CLIP-seq
MIRT2052077	hsa-miR-3122	CLIP-seq
MIRT2052078	hsa-miR-3128	CLIP-seq
MIRT2052080	hsa-miR-3612	CLIP-seq
MIRT1180060	hsa-miR-3622a-3p	CLIP-seq
MIRT1180061	hsa-miR-3622b-3p	CLIP-seq
MIRT2052082	hsa-miR-3664-5p	CLIP-seq
MIRT2052083	hsa-miR-3667-5p	CLIP-seq
MIRT2052084	hsa-miR-3689a-3p	CLIP-seq
MIRT2052085	hsa-miR-3689c	CLIP-seq
MIRT2579719	hsa-miR-371-5p	CLIP-seq
MIRT2579720	hsa-miR-371b-5p	CLIP-seq
MIRT2052086	hsa-miR-378	CLIP-seq
MIRT2052087	hsa-miR-378b	CLIP-seq
MIRT2052088	hsa-miR-378c	CLIP-seq
MIRT2052089	hsa-miR-378d	CLIP-seq
MIRT2052090	hsa-miR-378e	CLIP-seq
MIRT2052091	hsa-miR-378f	CLIP-seq
MIRT2052092	hsa-miR-378h	CLIP-seq
MIRT2052093	hsa-miR-378i	CLIP-seq
MIRT2052094	hsa-miR-3913-5p	CLIP-seq
MIRT2052096	hsa-miR-422a	CLIP-seq
MIRT2579721	hsa-miR-4281	CLIP-seq
MIRT1180064	hsa-miR-4423-5p	CLIP-seq
MIRT2579722	hsa-miR-4432	CLIP-seq
MIRT2052098	hsa-miR-4443	CLIP-seq
MIRT2052100	hsa-miR-4470	CLIP-seq
MIRT2579723	hsa-miR-451b	CLIP-seq
MIRT2052103	hsa-miR-4638-3p	CLIP-seq
MIRT2052105	hsa-miR-4696	CLIP-seq
MIRT2052107	hsa-miR-4714-5p	CLIP-seq
MIRT2579724	hsa-miR-4717-3p	CLIP-seq
MIRT2052109	hsa-miR-4728-5p	CLIP-seq
MIRT2052110	hsa-miR-4761-5p	CLIP-seq
MIRT2052112	hsa-miR-4782-5p	CLIP-seq
MIRT2052113	hsa-miR-4786-5p	CLIP-seq
MIRT2052115	hsa-miR-516b	CLIP-seq
MIRT2579725	hsa-miR-548a-5p	CLIP-seq
MIRT2579726	hsa-miR-548ab	CLIP-seq
MIRT2579727	hsa-miR-548ak	CLIP-seq
MIRT2579728	hsa-miR-548b-5p	CLIP-seq
MIRT1180051	hsa-miR-548c-3p	CLIP-seq
MIRT2579729	hsa-miR-548c-5p	CLIP-seq
MIRT2579730	hsa-miR-548d-5p	CLIP-seq
MIRT2579731	hsa-miR-548h	CLIP-seq
MIRT2579732	hsa-miR-548i	CLIP-seq
MIRT2579733	hsa-miR-548j	CLIP-seq
MIRT2579734	hsa-miR-548n	CLIP-seq
MIRT2579735	hsa-miR-548o	CLIP-seq
MIRT2579736	hsa-miR-548w	CLIP-seq
MIRT2579737	hsa-miR-548y	CLIP-seq
MIRT2579738	hsa-miR-559	CLIP-seq
MIRT2579739	hsa-miR-571	CLIP-seq
MIRT2052116	hsa-miR-650	CLIP-seq
MIRT2579710	hsa-miR-1228	CLIP-seq
MIRT2052068	hsa-miR-1273e	CLIP-seq
MIRT2052070	hsa-miR-1299	CLIP-seq
MIRT2052072	hsa-miR-183	CLIP-seq
MIRT2579713	hsa-miR-219-1-3p	CLIP-seq
MIRT2579714	hsa-miR-30a	CLIP-seq
MIRT2579715	hsa-miR-30b	CLIP-seq
MIRT2579716	hsa-miR-30c	CLIP-seq
MIRT2579717	hsa-miR-30d	CLIP-seq
MIRT2579718	hsa-miR-30e	CLIP-seq
MIRT2052076	hsa-miR-31	CLIP-seq
MIRT2052077	hsa-miR-3122	CLIP-seq
MIRT2052078	hsa-miR-3128	CLIP-seq
MIRT2052083	hsa-miR-3667-5p	CLIP-seq
MIRT2052084	hsa-miR-3689a-3p	CLIP-seq
MIRT2052085	hsa-miR-3689c	CLIP-seq
MIRT2052086	hsa-miR-378	CLIP-seq
MIRT2052087	hsa-miR-378b	CLIP-seq
MIRT2052088	hsa-miR-378c	CLIP-seq
MIRT2052089	hsa-miR-378d	CLIP-seq
MIRT2052090	hsa-miR-378e	CLIP-seq
MIRT2052091	hsa-miR-378f	CLIP-seq
MIRT2052092	hsa-miR-378h	CLIP-seq
MIRT2052093	hsa-miR-378i	CLIP-seq
MIRT2052094	hsa-miR-3913-5p	CLIP-seq
MIRT2052096	hsa-miR-422a	CLIP-seq
MIRT2579721	hsa-miR-4281	CLIP-seq
MIRT2052100	hsa-miR-4470	CLIP-seq
MIRT2052103	hsa-miR-4638-3p	CLIP-seq
MIRT2052105	hsa-miR-4696	CLIP-seq
MIRT2052109	hsa-miR-4728-5p	CLIP-seq
MIRT2052110	hsa-miR-4761-5p	CLIP-seq
MIRT2052112	hsa-miR-4782-5p	CLIP-seq
MIRT2052113	hsa-miR-4786-5p	CLIP-seq
MIRT2052115	hsa-miR-516b	CLIP-seq
MIRT2579725	hsa-miR-548a-5p	CLIP-seq
MIRT2579726	hsa-miR-548ab	CLIP-seq
MIRT2579727	hsa-miR-548ak	CLIP-seq
MIRT2579728	hsa-miR-548b-5p	CLIP-seq
MIRT1180051	hsa-miR-548c-3p	CLIP-seq
MIRT2579729	hsa-miR-548c-5p	CLIP-seq
MIRT2579730	hsa-miR-548d-5p	CLIP-seq
MIRT2579731	hsa-miR-548h	CLIP-seq
MIRT2579732	hsa-miR-548i	CLIP-seq
MIRT2579733	hsa-miR-548j	CLIP-seq
MIRT2579734	hsa-miR-548n	CLIP-seq
MIRT2579736	hsa-miR-548w	CLIP-seq
MIRT2579737	hsa-miR-548y	CLIP-seq
MIRT2579738	hsa-miR-559	CLIP-seq
MIRT2579739	hsa-miR-571	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003684	Function	Damaged DNA binding	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0003906	Function	DNA-(apurinic or apyrimidinic site) endonuclease activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006284	Process	Base-excision repair	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0008017	Function	Microtubule binding	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0015630	Component	Microtubule cytoskeleton	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016798	Function	Hydrolase activity, acting on glycosyl bonds	IEA
GO:0016799	Function	Hydrolase activity, hydrolyzing N-glycosyl compounds	IEA
GO:0016829	Function	Lyase activity	IEA
GO:0019104	Function	DNA N-glycosylase activity	IEA
GO:0019104	Function	DNA N-glycosylase activity	TAS
GO:0045008	Process	Depyrimidination	TAS
GO:0046872	Function	Metal ion binding	IEA
GO:0072686	Component	Mitotic spindle	IEA
GO:0140078	Function	Class I DNA-(apurinic or apyrimidinic site) endonuclease activity	IEA

MIM	HGNC	e!Ensembl
608933	18956	ENSG00000154328

Q969S2

Protein name

Endonuclease 8-like 2 (EC 3.2.2.-) (EC 4.2.99.18) (DNA glycosylase/AP lyase Neil2) (DNA-(apurinic or apyrimidinic site) lyase Neil2) (Endonuclease VIII-like 2) (Nei homolog 2) (NEH2) (Nei-like protein 2)

Protein function

Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Has DNA glycosylase activity towards 5-hydroxyuracil and other oxidized derivatives of cytosine with a preference for mismatched double-stranded DNA (DNA bubble

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06831	H2TH	193 → 275	Formamidopyrimidine-DNA glycosylase H2TH domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in testis, skeletal muscle, heart, brain, placenta, lung, pancreas, kidney and liver. {ECO:0000269|PubMed:12097317}.

Sequence

MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDE
EMGPPGSSPTPEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLER
DAPAGDAGRWLRVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNC
QLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEALYR
AGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKE
AFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS

Sequence length

332

Interactions

View interactions

	KEGG		Reactome
	Base excision repair		Recognition and association of DNA glycosylase with site containing an affected pyrimidine Cleavage of the damaged pyrimidine APEX1-Independent Resolution of AP Sites via the Single Nucleotide Replacement Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FRONTOTEMPORAL DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
High myopia	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR SARCOIDOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE MYOPIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (31)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	24698998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24698998, 31904337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18594018, 32198476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22497777, 24595271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiac defects	Cardiac Defects	BEFREE	23696316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne syndrome	Pubtator	24406253	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17029639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17029639, 32312920	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	23696316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	20074151	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	21884718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29935355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24595271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24698998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22497777, 24595271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	18594018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26373042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18594018, 22199273, 27042257, 27940348, 29383107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32572938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26373042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	18594018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	18594018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	28068351		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	28068351, 34704236, 37223019	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	32198476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	18594018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18594018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18594018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	18594018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26373042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	32198476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NEIL2 (nei like DNA glycosylase 2)