FUT7 (fucosyltransferase 7)

Gene

• Entrez ID: 2529
• Gene name: Fucosyltransferase 7
• Gene symbol: FUT7
• Synonyms (NCBI Gene): FucT-VII
• Chromosome: 9
• Chromosome location: 9q34.3
• Summary: The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X antigens. The encoded protein can direct the synthesis of the E-selectin-binding sialyl-Lewis X moiety. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT035912	hsa-miR-1180-3p	CLASH	23622248
MIRT1006780	hsa-miR-1245b-3p	CLIP-seq
MIRT1006781	hsa-miR-320e	CLIP-seq
MIRT1006782	hsa-miR-4330	CLIP-seq
MIRT1998287	hsa-miR-214	CLIP-seq
MIRT1006781	hsa-miR-320e	CLIP-seq
MIRT1998288	hsa-miR-3619-5p	CLIP-seq
MIRT1998289	hsa-miR-3620	CLIP-seq
MIRT1998290	hsa-miR-4269	CLIP-seq
MIRT1998291	hsa-miR-4690-5p	CLIP-seq
MIRT1998292	hsa-miR-5096	CLIP-seq
MIRT1998293	hsa-miR-761	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
GATA3	Unknown	17075044
TBX21	Unknown	17075044

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0001807	Process	Regulation of type IV hypersensitivity	IEA
GO:0001807	Process	Regulation of type IV hypersensitivity	ISS
GO:0002361	Process	CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation	IEA
GO:0002522	Process	Leukocyte migration involved in immune response	IEA
GO:0002523	Process	Leukocyte migration involved in inflammatory response	IEA
GO:0002523	Process	Leukocyte migration involved in inflammatory response	ISS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005794	Component	Golgi apparatus	IDA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	TAS	11698403
GO:0005802	Component	Trans-Golgi network	IDA	23192350
GO:0006486	Process	Protein glycosylation	IDA	11404359
GO:0006486	Process	Protein glycosylation	IEA
GO:0006486	Process	Protein glycosylation	TAS	11698403
GO:0006665	Process	Sphingolipid metabolic process	IEA
GO:0006672	Process	Ceramide metabolic process	IDA	9299472
GO:0006954	Process	Inflammatory response	ISS
GO:0007566	Process	Embryo implantation	IMP	18402946
GO:0008417	Function	Fucosyltransferase activity	IDA	9299472, 11404359
GO:0008417	Function	Fucosyltransferase activity	IEA
GO:0009312	Process	Oligosaccharide biosynthetic process	IEA
GO:0009312	Process	Oligosaccharide biosynthetic process	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	8207002
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0017083	Function	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IDA	9473504
GO:0017083	Function	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IEA
GO:0022407	Process	Regulation of cell-cell adhesion	IMP	10200296
GO:0022409	Process	Positive regulation of cell-cell adhesion	IMP	18553500
GO:0032580	Component	Golgi cisterna membrane	IEA
GO:0036065	Process	Fucosylation	IBA
GO:0042355	Process	L-fucose catabolic process	NAS	11698403
GO:0045785	Process	Positive regulation of cell adhesion	IMP	10386892
GO:0046626	Process	Regulation of insulin receptor signaling pathway	IMP	17229154
GO:0046920	Function	Alpha-(1->3)-fucosyltransferase activity	IBA
GO:0046920	Function	Alpha-(1->3)-fucosyltransferase activity	IDA	8207002, 9299472, 9405391, 9461592, 11278338
GO:0046920	Function	Alpha-(1->3)-fucosyltransferase activity	IEA
GO:0046920	Function	Alpha-(1->3)-fucosyltransferase activity	IMP	15926890, 23192350
GO:0046920	Function	Alpha-(1->3)-fucosyltransferase activity	TAS	11698403
GO:0060353	Process	Regulation of cell adhesion molecule production	IMP	8666674
GO:0072678	Process	T cell migration	IEA
GO:0097021	Process	Lymphocyte migration into lymphoid organs	IEA
GO:0097022	Process	Lymphocyte migration into lymph node	IEA
GO:0097022	Process	Lymphocyte migration into lymph node	ISS
GO:1902624	Process	Positive regulation of neutrophil migration	IEA
GO:1902624	Process	Positive regulation of neutrophil migration	ISS
GO:1903037	Process	Regulation of leukocyte cell-cell adhesion	IMP	23192350
GO:1903236	Process	Regulation of leukocyte tethering or rolling	IMP	23192350
GO:1903238	Process	Positive regulation of leukocyte tethering or rolling	IEA
GO:1903238	Process	Positive regulation of leukocyte tethering or rolling	ISS
GO:1904994	Process	Regulation of leukocyte adhesion to vascular endothelial cell	IEA
GO:1904996	Process	Positive regulation of leukocyte adhesion to vascular endothelial cell	IMP	29138114
GO:2000389	Process	Regulation of neutrophil extravasation	IEA

Other IDs

• MIM: 602030
• HGNC: 4018
• e!Ensembl: ENSG00000180549

Protein

• UniProt ID: Q11130
• Protein name: Alpha-(1,3)-fucosyltransferase 7 (EC 2.4.1.-) (Fucosyltransferase 7) (Fucosyltransferase VII) (Fuc-TVII) (FucT-VII) (Galactoside 3-L-fucosyltransferase) (Selectin ligand synthase)
• Protein function: Catalyzes the transfer of L-fucose, from a guanosine diphosphate-beta-L-fucose, to the N-acetyl glucosamine (GlcNAc) of a distal alpha2,3 sialylated lactosamine unit of a glycoprotein or a glycolipid-linked sialopolylactosamines chain through an
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF17039	Glyco_tran_10_N	44 → 154	Fucosyltransferase, N-terminal	Domain
  PF00852	Glyco_transf_10	169 → 340	Glycosyltransferase family 10 (fucosyltransferase) C-term	Family

• Tissue specificity: TISSUE SPECIFICITY: Leukocytic/myeloid lineage cells.
• Sequence:

  MNNAGHGPTRRLRGLGVLAGVALLAALWLLWLLGSAPRGTPAPQPTITILVWHWPFTDQP
  PELPSDTCTRYGIARCHLSANRSLLASADAVVFHHRELQTRRSHLPLAQRPRGQPWVWAS
  MESPSHTHGLSHLRGIFNWVLSYRRDSDIFVPYGRLEPHWGPSPPLPAKSRVAAWVVSNF
  QERQLRARLYRQLAPHLRVDVFGRANGRPLCASCLVPTVAQYRFYLSFENSQHRDYITEK
  FWRNALVAGTVPVVLGPPRATYEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFA
  WRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA

• Sequence length: 342

Pathways

KEGG:

Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways

Reactome:

Lewis blood group biosynthesis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	8981094		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29138114		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29138114		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	8542587, 9128982		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35955933	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36463240	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20965272		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20428816		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	20428816		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	27591321		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	7775258	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	24597656		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	27591321		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	24953795		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11422380, 15666088, 30226570		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	36463240	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	8542587		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20833389		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20965272		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	GWASDB_DG	21211798		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20428816, 30226570, 9128982		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	20833389		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19889975	Stimulate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	15666088		★☆☆☆☆ Found in Text Mining only
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34134578	Associate	★☆☆☆☆ Found in Text Mining only