Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2526
Gene name	Fucosyltransferase 4
Gene symbol	FUT4
Synonyms (NCBI Gene)	CD15ELFTFCT3AFUC-TIVFUTIVLeXSSEA-1
Chromosome	11
Chromosome location	11q21
Summary	The product of this gene transfers fucose to N-acetyllactosamine polysaccharides to generate fucosylated carbohydrate structures. It catalyzes the synthesis of the non-sialylated antigen, Lewis x (CD15). [provided by RefSeq, Jan 2009]

359

Show/Hide all (359)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006453	hsa-miR-199a-3p	FlowImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	22411914
MIRT722795	hsa-miR-5586-5p	HITS-CLIP	19536157
MIRT722794	hsa-miR-383-3p	HITS-CLIP	19536157
MIRT722793	hsa-miR-4530	HITS-CLIP	19536157
MIRT722792	hsa-miR-338-3p	HITS-CLIP	19536157
MIRT722791	hsa-miR-2115-5p	HITS-CLIP	19536157
MIRT722790	hsa-miR-516a-3p	HITS-CLIP	19536157
MIRT722789	hsa-miR-516b-3p	HITS-CLIP	19536157
MIRT722788	hsa-miR-7162-5p	HITS-CLIP	19536157
MIRT722787	hsa-miR-3977	HITS-CLIP	19536157
MIRT722786	hsa-miR-6885-3p	HITS-CLIP	19536157
MIRT269206	hsa-miR-23c	PAR-CLIP	21572407
MIRT269204	hsa-miR-23b-3p	PAR-CLIP	21572407
MIRT269203	hsa-miR-23a-3p	PAR-CLIP	21572407
MIRT269205	hsa-miR-130a-5p	PAR-CLIP	21572407
MIRT557743	hsa-miR-10a-3p	PAR-CLIP	21572407
MIRT557742	hsa-miR-5571-5p	PAR-CLIP	21572407
MIRT557741	hsa-miR-136-5p	PAR-CLIP	21572407
MIRT557740	hsa-miR-515-5p	PAR-CLIP	21572407
MIRT557739	hsa-miR-519e-5p	PAR-CLIP	21572407
MIRT557738	hsa-miR-3143	PAR-CLIP	21572407
MIRT497522	hsa-miR-3662	PAR-CLIP	22291592
MIRT497521	hsa-miR-3913-3p	PAR-CLIP	22291592
MIRT497520	hsa-miR-489-3p	PAR-CLIP	22291592
MIRT733038	hsa-miR-125a-5p	Immunohistochemistry (IHC)Immunoprecipitaion (IP)In situ hybridizationLuciferase reporter assayRNA-seqqRT-PCRWestern blotting	33520365
MIRT722795	hsa-miR-5586-5p	HITS-CLIP	19536157
MIRT722794	hsa-miR-383-3p	HITS-CLIP	19536157
MIRT722793	hsa-miR-4530	HITS-CLIP	19536157
MIRT722792	hsa-miR-338-3p	HITS-CLIP	19536157
MIRT722791	hsa-miR-2115-5p	HITS-CLIP	19536157
MIRT722790	hsa-miR-516a-3p	HITS-CLIP	19536157
MIRT722789	hsa-miR-516b-3p	HITS-CLIP	19536157
MIRT722788	hsa-miR-7162-5p	HITS-CLIP	19536157
MIRT722787	hsa-miR-3977	HITS-CLIP	19536157
MIRT722786	hsa-miR-6885-3p	HITS-CLIP	19536157
MIRT269206	hsa-miR-23c	PAR-CLIP	21572407
MIRT269204	hsa-miR-23b-3p	PAR-CLIP	21572407
MIRT269203	hsa-miR-23a-3p	PAR-CLIP	21572407
MIRT269205	hsa-miR-130a-5p	PAR-CLIP	21572407
MIRT557743	hsa-miR-10a-3p	PAR-CLIP	21572407
MIRT557742	hsa-miR-5571-5p	PAR-CLIP	21572407
MIRT557741	hsa-miR-136-5p	PAR-CLIP	21572407
MIRT557740	hsa-miR-515-5p	PAR-CLIP	21572407
MIRT557739	hsa-miR-519e-5p	PAR-CLIP	21572407
MIRT557738	hsa-miR-3143	PAR-CLIP	21572407
MIRT497522	hsa-miR-3662	PAR-CLIP	22291592
MIRT497521	hsa-miR-3913-3p	PAR-CLIP	22291592
MIRT497520	hsa-miR-489-3p	PAR-CLIP	22291592
MIRT1006574	hsa-miR-106a	CLIP-seq
MIRT1006575	hsa-miR-106b	CLIP-seq
MIRT1006576	hsa-miR-1200	CLIP-seq
MIRT1006577	hsa-miR-1205	CLIP-seq
MIRT1006578	hsa-miR-1207-3p	CLIP-seq
MIRT1006579	hsa-miR-1224-5p	CLIP-seq
MIRT1006580	hsa-miR-1231	CLIP-seq
MIRT1006581	hsa-miR-1256	CLIP-seq
MIRT1006582	hsa-miR-1257	CLIP-seq
MIRT1006583	hsa-miR-125b	CLIP-seq
MIRT1006584	hsa-miR-127-5p	CLIP-seq
MIRT1006585	hsa-miR-1279	CLIP-seq
MIRT1006586	hsa-miR-1286	CLIP-seq
MIRT1006587	hsa-miR-1297	CLIP-seq
MIRT1006588	hsa-miR-1305	CLIP-seq
MIRT1006589	hsa-miR-1343	CLIP-seq
MIRT1006590	hsa-miR-136	CLIP-seq
MIRT1006591	hsa-miR-142-3p	CLIP-seq
MIRT1006592	hsa-miR-17	CLIP-seq
MIRT1006593	hsa-miR-181a	CLIP-seq
MIRT1006594	hsa-miR-181b	CLIP-seq
MIRT1006595	hsa-miR-181c	CLIP-seq
MIRT1006596	hsa-miR-181d	CLIP-seq
MIRT1006597	hsa-miR-1827	CLIP-seq
MIRT1006598	hsa-miR-1911	CLIP-seq
MIRT1006599	hsa-miR-1913	CLIP-seq
MIRT1006600	hsa-miR-1976	CLIP-seq
MIRT1006601	hsa-miR-19a	CLIP-seq
MIRT1006602	hsa-miR-19b	CLIP-seq
MIRT1006603	hsa-miR-200b	CLIP-seq
MIRT1006604	hsa-miR-200c	CLIP-seq
MIRT1006605	hsa-miR-2054	CLIP-seq
MIRT1006606	hsa-miR-20a	CLIP-seq
MIRT1006607	hsa-miR-20b	CLIP-seq
MIRT1006608	hsa-miR-219-2-3p	CLIP-seq
MIRT1006609	hsa-miR-223	CLIP-seq
MIRT1006610	hsa-miR-224	CLIP-seq
MIRT1006611	hsa-miR-2355-3p	CLIP-seq
MIRT1006612	hsa-miR-26a	CLIP-seq
MIRT1006613	hsa-miR-26b	CLIP-seq
MIRT1006614	hsa-miR-296-3p	CLIP-seq
MIRT1006615	hsa-miR-2964a-3p	CLIP-seq
MIRT1006616	hsa-miR-302a	CLIP-seq
MIRT1006617	hsa-miR-302b	CLIP-seq
MIRT1006618	hsa-miR-302c	CLIP-seq
MIRT1006619	hsa-miR-302d	CLIP-seq
MIRT1006620	hsa-miR-302e	CLIP-seq
MIRT1006621	hsa-miR-3128	CLIP-seq
MIRT1006622	hsa-miR-3133	CLIP-seq
MIRT1006623	hsa-miR-3155	CLIP-seq
MIRT1006624	hsa-miR-3155b	CLIP-seq
MIRT1006625	hsa-miR-3165	CLIP-seq
MIRT1006626	hsa-miR-3169	CLIP-seq
MIRT1006627	hsa-miR-3180-5p	CLIP-seq
MIRT1006628	hsa-miR-3183	CLIP-seq
MIRT1006629	hsa-miR-3192	CLIP-seq
MIRT1006630	hsa-miR-324-3p	CLIP-seq
MIRT1006631	hsa-miR-3609	CLIP-seq
MIRT1006632	hsa-miR-3611	CLIP-seq
MIRT1006633	hsa-miR-3613-3p	CLIP-seq
MIRT1006634	hsa-miR-3622a-5p	CLIP-seq
MIRT1006635	hsa-miR-362-5p	CLIP-seq
MIRT1006636	hsa-miR-3677-5p	CLIP-seq
MIRT1006637	hsa-miR-3682-5p	CLIP-seq
MIRT1006638	hsa-miR-3688-3p	CLIP-seq
MIRT1006639	hsa-miR-3689a-3p	CLIP-seq
MIRT1006640	hsa-miR-3689c	CLIP-seq
MIRT1006641	hsa-miR-371b-5p	CLIP-seq
MIRT1006642	hsa-miR-372	CLIP-seq
MIRT1006643	hsa-miR-373	CLIP-seq
MIRT1006644	hsa-miR-374c	CLIP-seq
MIRT1006645	hsa-miR-384	CLIP-seq
MIRT1006646	hsa-miR-3909	CLIP-seq
MIRT1006647	hsa-miR-3919	CLIP-seq
MIRT1006648	hsa-miR-3929	CLIP-seq
MIRT1006649	hsa-miR-3974	CLIP-seq
MIRT1006650	hsa-miR-3978	CLIP-seq
MIRT1006651	hsa-miR-423-3p	CLIP-seq
MIRT1006652	hsa-miR-4261	CLIP-seq
MIRT1006653	hsa-miR-4262	CLIP-seq
MIRT1006654	hsa-miR-4268	CLIP-seq
MIRT1006655	hsa-miR-4277	CLIP-seq
MIRT1006656	hsa-miR-429	CLIP-seq
MIRT1006657	hsa-miR-4319	CLIP-seq
MIRT1006658	hsa-miR-4324	CLIP-seq
MIRT1006659	hsa-miR-4329	CLIP-seq
MIRT1006660	hsa-miR-4419b	CLIP-seq
MIRT1006661	hsa-miR-4423-3p	CLIP-seq
MIRT1006662	hsa-miR-4433	CLIP-seq
MIRT1006663	hsa-miR-4448	CLIP-seq
MIRT1006664	hsa-miR-4457	CLIP-seq
MIRT1006665	hsa-miR-4459	CLIP-seq
MIRT1006666	hsa-miR-4465	CLIP-seq
MIRT1006667	hsa-miR-4474-5p	CLIP-seq
MIRT1006668	hsa-miR-4478	CLIP-seq
MIRT1006669	hsa-miR-448	CLIP-seq
MIRT1006670	hsa-miR-450b-5p	CLIP-seq
MIRT1006671	hsa-miR-4511	CLIP-seq
MIRT1006672	hsa-miR-4515	CLIP-seq
MIRT1006673	hsa-miR-4528	CLIP-seq
MIRT1006674	hsa-miR-4539	CLIP-seq
MIRT1006675	hsa-miR-4646-3p	CLIP-seq
MIRT1006676	hsa-miR-4649-3p	CLIP-seq
MIRT1006677	hsa-miR-4680-5p	CLIP-seq
MIRT1006678	hsa-miR-4697-3p	CLIP-seq
MIRT1006679	hsa-miR-4703-3p	CLIP-seq
MIRT1006680	hsa-miR-4720-5p	CLIP-seq
MIRT1006681	hsa-miR-4722-5p	CLIP-seq
MIRT1006682	hsa-miR-4723-3p	CLIP-seq
MIRT1006683	hsa-miR-4724-5p	CLIP-seq
MIRT1006684	hsa-miR-4727-5p	CLIP-seq
MIRT1006685	hsa-miR-4728-5p	CLIP-seq
MIRT1006686	hsa-miR-4732-3p	CLIP-seq
MIRT1006687	hsa-miR-4738-3p	CLIP-seq
MIRT1006688	hsa-miR-4751	CLIP-seq
MIRT1006689	hsa-miR-4756-3p	CLIP-seq
MIRT1006690	hsa-miR-4760-5p	CLIP-seq
MIRT1006691	hsa-miR-4768-3p	CLIP-seq
MIRT1006692	hsa-miR-4769-3p	CLIP-seq
MIRT1006693	hsa-miR-4775	CLIP-seq
MIRT1006694	hsa-miR-4778-3p	CLIP-seq
MIRT1006695	hsa-miR-4796-3p	CLIP-seq
MIRT1006696	hsa-miR-4799-3p	CLIP-seq
MIRT1006697	hsa-miR-483-3p	CLIP-seq
MIRT1006698	hsa-miR-484	CLIP-seq
MIRT1006699	hsa-miR-485-5p	CLIP-seq
MIRT1006700	hsa-miR-489	CLIP-seq
MIRT1006701	hsa-miR-490-3p	CLIP-seq
MIRT1006702	hsa-miR-498	CLIP-seq
MIRT1006703	hsa-miR-500b	CLIP-seq
MIRT1006704	hsa-miR-501-5p	CLIP-seq
MIRT1006705	hsa-miR-513b	CLIP-seq
MIRT1006706	hsa-miR-513c	CLIP-seq
MIRT1006707	hsa-miR-514b-5p	CLIP-seq
MIRT1006708	hsa-miR-519d	CLIP-seq
MIRT1006709	hsa-miR-520a-3p	CLIP-seq
MIRT1006710	hsa-miR-520a-5p	CLIP-seq
MIRT1006711	hsa-miR-520b	CLIP-seq
MIRT1006712	hsa-miR-520c-3p	CLIP-seq
MIRT1006713	hsa-miR-520d-3p	CLIP-seq
MIRT1006714	hsa-miR-520e	CLIP-seq
MIRT1006715	hsa-miR-525-5p	CLIP-seq
MIRT1006716	hsa-miR-544	CLIP-seq
MIRT1006717	hsa-miR-544b	CLIP-seq
MIRT1006718	hsa-miR-548a-3p	CLIP-seq
MIRT1006719	hsa-miR-548ae	CLIP-seq
MIRT1006720	hsa-miR-548ah	CLIP-seq
MIRT1006721	hsa-miR-548aj	CLIP-seq
MIRT1006722	hsa-miR-548am	CLIP-seq
MIRT1006723	hsa-miR-548e	CLIP-seq
MIRT1006724	hsa-miR-548f	CLIP-seq
MIRT1006725	hsa-miR-548x	CLIP-seq
MIRT1006726	hsa-miR-577	CLIP-seq
MIRT1006727	hsa-miR-587	CLIP-seq
MIRT1006728	hsa-miR-624	CLIP-seq
MIRT1006729	hsa-miR-633	CLIP-seq
MIRT1006730	hsa-miR-642b	CLIP-seq
MIRT1006731	hsa-miR-655	CLIP-seq
MIRT1006732	hsa-miR-658	CLIP-seq
MIRT1006733	hsa-miR-670	CLIP-seq
MIRT1006734	hsa-miR-676	CLIP-seq
MIRT1006735	hsa-miR-875-3p	CLIP-seq
MIRT1006736	hsa-miR-93	CLIP-seq
MIRT1006737	hsa-miR-940	CLIP-seq
MIRT1006629	hsa-miR-3192	CLIP-seq
MIRT1006639	hsa-miR-3689a-3p	CLIP-seq
MIRT1006640	hsa-miR-3689c	CLIP-seq
MIRT1006685	hsa-miR-4728-5p	CLIP-seq
MIRT1006701	hsa-miR-490-3p	CLIP-seq
MIRT1006732	hsa-miR-658	CLIP-seq
MIRT1006578	hsa-miR-1207-3p	CLIP-seq
MIRT1006579	hsa-miR-1224-5p	CLIP-seq
MIRT1998263	hsa-miR-1238	CLIP-seq
MIRT1998264	hsa-miR-128	CLIP-seq
MIRT1006591	hsa-miR-142-3p	CLIP-seq
MIRT1006597	hsa-miR-1827	CLIP-seq
MIRT1998265	hsa-miR-205	CLIP-seq
MIRT1006610	hsa-miR-224	CLIP-seq
MIRT1998266	hsa-miR-2467-5p	CLIP-seq
MIRT1998267	hsa-miR-27a	CLIP-seq
MIRT1998268	hsa-miR-27b	CLIP-seq
MIRT1998269	hsa-miR-297	CLIP-seq
MIRT1006629	hsa-miR-3192	CLIP-seq
MIRT1998270	hsa-miR-3607-3p	CLIP-seq
MIRT1006634	hsa-miR-3622a-5p	CLIP-seq
MIRT1998271	hsa-miR-3652	CLIP-seq
MIRT1998272	hsa-miR-3686	CLIP-seq
MIRT1006639	hsa-miR-3689a-3p	CLIP-seq
MIRT1006640	hsa-miR-3689c	CLIP-seq
MIRT1006648	hsa-miR-3929	CLIP-seq
MIRT1006651	hsa-miR-423-3p	CLIP-seq
MIRT1006660	hsa-miR-4419b	CLIP-seq
MIRT1006661	hsa-miR-4423-3p	CLIP-seq
MIRT1998273	hsa-miR-4430	CLIP-seq
MIRT1006662	hsa-miR-4433	CLIP-seq
MIRT1998274	hsa-miR-4436a	CLIP-seq
MIRT1006663	hsa-miR-4448	CLIP-seq
MIRT1006665	hsa-miR-4459	CLIP-seq
MIRT1006667	hsa-miR-4474-5p	CLIP-seq
MIRT1006668	hsa-miR-4478	CLIP-seq
MIRT1998275	hsa-miR-4505	CLIP-seq
MIRT1006676	hsa-miR-4649-3p	CLIP-seq
MIRT1006677	hsa-miR-4680-5p	CLIP-seq
MIRT1006681	hsa-miR-4722-5p	CLIP-seq
MIRT1006684	hsa-miR-4727-5p	CLIP-seq
MIRT1006685	hsa-miR-4728-5p	CLIP-seq
MIRT1006688	hsa-miR-4751	CLIP-seq
MIRT1006691	hsa-miR-4768-3p	CLIP-seq
MIRT1006692	hsa-miR-4769-3p	CLIP-seq
MIRT1998276	hsa-miR-4797-3p	CLIP-seq
MIRT1006699	hsa-miR-485-5p	CLIP-seq
MIRT1006701	hsa-miR-490-3p	CLIP-seq
MIRT1998277	hsa-miR-510	CLIP-seq
MIRT1998278	hsa-miR-512-5p	CLIP-seq
MIRT1998279	hsa-miR-550b	CLIP-seq
MIRT1998280	hsa-miR-566	CLIP-seq
MIRT1998281	hsa-miR-567	CLIP-seq
MIRT1998282	hsa-miR-576-5p	CLIP-seq
MIRT1006727	hsa-miR-587	CLIP-seq
MIRT1006729	hsa-miR-633	CLIP-seq
MIRT1006732	hsa-miR-658	CLIP-seq
MIRT1006737	hsa-miR-940	CLIP-seq
MIRT2231939	hsa-miR-1185	CLIP-seq
MIRT1006578	hsa-miR-1207-3p	CLIP-seq
MIRT1006583	hsa-miR-125b	CLIP-seq
MIRT2231940	hsa-miR-1294	CLIP-seq
MIRT1006597	hsa-miR-1827	CLIP-seq
MIRT2231941	hsa-miR-3120-5p	CLIP-seq
MIRT2231942	hsa-miR-3146	CLIP-seq
MIRT1006625	hsa-miR-3165	CLIP-seq
MIRT1006629	hsa-miR-3192	CLIP-seq
MIRT2231943	hsa-miR-3201	CLIP-seq
MIRT2231944	hsa-miR-3605-5p	CLIP-seq
MIRT1006633	hsa-miR-3613-3p	CLIP-seq
MIRT2231945	hsa-miR-3665	CLIP-seq
MIRT2231946	hsa-miR-3679-5p	CLIP-seq
MIRT1006639	hsa-miR-3689a-3p	CLIP-seq
MIRT1006640	hsa-miR-3689c	CLIP-seq
MIRT1006648	hsa-miR-3929	CLIP-seq
MIRT1006649	hsa-miR-3974	CLIP-seq
MIRT1006651	hsa-miR-423-3p	CLIP-seq
MIRT2231947	hsa-miR-4252	CLIP-seq
MIRT2231948	hsa-miR-4316	CLIP-seq
MIRT1006657	hsa-miR-4319	CLIP-seq
MIRT1006660	hsa-miR-4419b	CLIP-seq
MIRT1006662	hsa-miR-4433	CLIP-seq
MIRT1006664	hsa-miR-4457	CLIP-seq
MIRT1006665	hsa-miR-4459	CLIP-seq
MIRT1006667	hsa-miR-4474-5p	CLIP-seq
MIRT1006668	hsa-miR-4478	CLIP-seq
MIRT1006676	hsa-miR-4649-3p	CLIP-seq
MIRT2231949	hsa-miR-4668-5p	CLIP-seq
MIRT1006681	hsa-miR-4722-5p	CLIP-seq
MIRT1006684	hsa-miR-4727-5p	CLIP-seq
MIRT1006685	hsa-miR-4728-5p	CLIP-seq
MIRT1006686	hsa-miR-4732-3p	CLIP-seq
MIRT2231950	hsa-miR-4736	CLIP-seq
MIRT2231951	hsa-miR-4763-5p	CLIP-seq
MIRT1006691	hsa-miR-4768-3p	CLIP-seq
MIRT2231952	hsa-miR-4791	CLIP-seq
MIRT1006699	hsa-miR-485-5p	CLIP-seq
MIRT1006701	hsa-miR-490-3p	CLIP-seq
MIRT1006705	hsa-miR-513b	CLIP-seq
MIRT2231953	hsa-miR-548c-3p	CLIP-seq
MIRT1998280	hsa-miR-566	CLIP-seq
MIRT1006727	hsa-miR-587	CLIP-seq
MIRT2231954	hsa-miR-596	CLIP-seq
MIRT1006728	hsa-miR-624	CLIP-seq
MIRT1006732	hsa-miR-658	CLIP-seq
MIRT1006733	hsa-miR-670	CLIP-seq
MIRT1006737	hsa-miR-940	CLIP-seq
MIRT2231955	hsa-miR-944	CLIP-seq
MIRT1006629	hsa-miR-3192	CLIP-seq
MIRT1006684	hsa-miR-4727-5p	CLIP-seq
MIRT2535879	hsa-miR-147	CLIP-seq
MIRT1006597	hsa-miR-1827	CLIP-seq
MIRT1006605	hsa-miR-2054	CLIP-seq
MIRT1006629	hsa-miR-3192	CLIP-seq
MIRT2535880	hsa-miR-3617	CLIP-seq
MIRT1006639	hsa-miR-3689a-3p	CLIP-seq
MIRT1006640	hsa-miR-3689c	CLIP-seq
MIRT1006681	hsa-miR-4722-5p	CLIP-seq
MIRT1006685	hsa-miR-4728-5p	CLIP-seq
MIRT1006691	hsa-miR-4768-3p	CLIP-seq
MIRT1006701	hsa-miR-490-3p	CLIP-seq
MIRT2535881	hsa-miR-513a-3p	CLIP-seq
MIRT2231953	hsa-miR-548c-3p	CLIP-seq
MIRT2535882	hsa-miR-548u	CLIP-seq
MIRT2535883	hsa-miR-641	CLIP-seq
MIRT1006732	hsa-miR-658	CLIP-seq
MIRT1006737	hsa-miR-940	CLIP-seq
MIRT2681232	hsa-miR-1228	CLIP-seq
MIRT2535879	hsa-miR-147	CLIP-seq
MIRT1006597	hsa-miR-1827	CLIP-seq
MIRT1006629	hsa-miR-3192	CLIP-seq
MIRT2535880	hsa-miR-3617	CLIP-seq
MIRT1006639	hsa-miR-3689a-3p	CLIP-seq
MIRT1006640	hsa-miR-3689c	CLIP-seq
MIRT2681233	hsa-miR-3921	CLIP-seq
MIRT2681234	hsa-miR-4251	CLIP-seq
MIRT2681235	hsa-miR-4267	CLIP-seq
MIRT1006659	hsa-miR-4329	CLIP-seq
MIRT2681236	hsa-miR-4653-5p	CLIP-seq
MIRT1006681	hsa-miR-4722-5p	CLIP-seq
MIRT1006685	hsa-miR-4728-5p	CLIP-seq
MIRT1006691	hsa-miR-4768-3p	CLIP-seq
MIRT1006701	hsa-miR-490-3p	CLIP-seq
MIRT2535882	hsa-miR-548u	CLIP-seq
MIRT2535883	hsa-miR-641	CLIP-seq
MIRT1006732	hsa-miR-658	CLIP-seq
MIRT1006737	hsa-miR-940	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
ELK1	Unknown	11006292
HSF1	Unknown	23959823
SP1	Unknown	23959823

Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	TAS	11698403
GO:0005802	Component	Trans-Golgi network	IDA	23192350
GO:0005975	Process	Carbohydrate metabolic process	TAS	1716630
GO:0006486	Process	Protein glycosylation	IEA
GO:0006486	Process	Protein glycosylation	TAS	11698403
GO:0006487	Process	Protein N-linked glycosylation	IDA	29593094
GO:0006493	Process	Protein O-linked glycosylation	IDA	29593094
GO:0006665	Process	Sphingolipid metabolic process	IEA
GO:0006688	Process	Glycosphingolipid biosynthetic process	IDA	29593094
GO:0006954	Process	Inflammatory response	IEA
GO:0008417	Function	Fucosyltransferase activity	IEA
GO:0008417	Function	Fucosyltransferase activity	TAS	1716630
GO:0009311	Process	Oligosaccharide metabolic process	IDA	1740457
GO:0009312	Process	Oligosaccharide biosynthetic process	IEA
GO:0009312	Process	Oligosaccharide biosynthetic process	TAS
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	1716630
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0017083	Function	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IDA	1740457, 11278338, 29593094
GO:0017083	Function	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IEA
GO:0017083	Function	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IMP	23192350
GO:0032580	Component	Golgi cisterna membrane	IEA
GO:0036065	Process	Fucosylation	IBA
GO:0042355	Process	L-fucose catabolic process	NAS	11698403
GO:0046920	Function	Alpha-(1->3)-fucosyltransferase activity	IBA
GO:0046920	Function	Alpha-(1->3)-fucosyltransferase activity	IEA
GO:0046920	Function	Alpha-(1->3)-fucosyltransferase activity	TAS	11698403
GO:0071944	Component	Cell periphery	IEA
GO:0097022	Process	Lymphocyte migration into lymph node	IEA
GO:0097022	Process	Lymphocyte migration into lymph node	ISS
GO:0106402	Process	Lewis x epitope biosynthetic process	IDA	29593094
GO:1902624	Process	Positive regulation of neutrophil migration	IEA
GO:1902624	Process	Positive regulation of neutrophil migration	ISS
GO:1903037	Process	Regulation of leukocyte cell-cell adhesion	IMP	23192350
GO:1903238	Process	Positive regulation of leukocyte tethering or rolling	IEA
GO:1903238	Process	Positive regulation of leukocyte tethering or rolling	ISS

MIM	HGNC	e!Ensembl
104230	4015	ENSG00000196371

P22083

Protein name

Alpha-(1,3)-fucosyltransferase 4 (4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase) (EC 2.4.1.152) (ELAM-1 ligand fucosyltransferase) (Fucosyltransferase 4) (Fucosyltransferase IV) (Fuc-TIV) (FucT-IV) (Galactoside 3-L-fucosyltransferase)

Protein function

[Isoform Short]: Catalyzes alpha(1->3) linkage of fucosyl moiety transferred from GDP-beta-L-fucose to N-acetyl glucosamine (GlcNAc) within type 2 lactosamine (LacNAc, Gal-beta(1->4)GlcNAc) glycan attached to N- or O-linked glycoproteins (PubMed

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF17039	Glyco_tran_10_N	186 → 331	Fucosyltransferase, N-terminal	Domain
PF00852	Glyco_transf_10	353 → 528	Glycosyltransferase family 10 (fucosyltransferase) C-term	Family

Tissue specificity

TISSUE SPECIFICITY: [Isoform Short]: Expressed at low levels in bone marrow-derived mesenchymal stem cells. {ECO:0000269|PubMed:29593094}.; TISSUE SPECIFICITY: Expressed in cord blood immature promyelocytes and in peripheral blood myeloid and lymphoid cel

Sequence

MRRLWGAARKPSGAGWEKEWAEAPQEAPGAWSGRLGPGRSGRKGRAVPGWASWPAHLALA
ARPARHLGGAGQGPRPLHSGTAPFHSRASGERQRRLEPQLQHESRCRSSTPADAWRAEAA
LPVRAMGAPWGSPTAAAGGRRGWRRGRGLPWTVCVLAAAGLTCTALITYACWGQLPPLPW
ASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFNISGCRLLTDRASYGEAQAVLFHHR
DLVKGPPDWPPPWGIQAHTAEEVDLRVLDYEEAAAAAEALATSSPRPPGQRWVWMNFESP
SHSPGLRSLASNLFNWTLSYRADSDVFVPYGYLYPRSHPGDPPSGLAPPLSRKQGLVAWV
VSHWDERQARVRYYHQLSQHVTVDVFGRGGPGQPVPEIGLLHTVARYKFYLAFENSQHLD
YITEKLWRNALLAGAVPVVLGPDRANYERFVPRGAFIHVDDFPSASSLASYLLFLDRNPA
VYRRYFHWRRSYAVHITSFWDEPWCRVCQAVQRAGDRPKSIRNLASWFER

Sequence length

530

Interactions

View interactions

	KEGG		Reactome
	Mannose type O-glycan biosynthesis Glycosphingolipid biosynthesis - lacto and neolacto series Metabolic pathways		Lewis blood group biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
THROMBOSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (183)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute leukemia	Leukemia	BEFREE	1375695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	11520279, 11531016, 1477645, 30683310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	BEFREE	2646903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	25241285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	21812014, 7815843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	24195468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	10747292, 10873613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28423676, 30357521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	10608618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	2885160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	2885160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11520279, 11531016, 12886247, 1477645, 7908708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	12670918, 29742695, 30350336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	19185848, 22411914, 23592496, 25921740, 26938241, 30657775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	14533803, 9070245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amaurosis congenita of Leber, type 1	Leber congenital amaurosis	BEFREE	8750633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angiolymphoid hyperplasia	Angiolymphoid Hyperplasia	BEFREE	7685151		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27256393, 29408556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	40270010	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	18668606	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	39684771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	39684771, 9858207	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	31222115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	21365622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	22771507		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	15599663		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	19843386, 40121643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	15599663		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta^0^ Thalassemia	beta Thalassemia	BEFREE	16126871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30372804, 30867744, 31706102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	7913433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	24086629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20231016, 23887626, 23959823, 26701615, 27375041, 28692034, 29685380, 30941952, 31054033, 31839366, 9663428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12029441, 1905702, 28399903, 37477396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23887626	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	21473743, 22287018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	29215790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	8679447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24232099, 34157683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29211299	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30372804, 30867744, 31706102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	10852523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10449611, 21437888, 26636541, 31104223, 8542587, 9128982, 9133454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22799384, 7692735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	29809052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Castleman Disease	Castleman disease	Pubtator	7685151	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	1348055	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	26546613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	11520279, 11531016, 1477645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	19185848, 22411914, 23592496, 25921740, 26938241, 30657775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	25945010	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choreoathetosis Hypothyroidism And Neonatal Respiratory Distress	Choreoathetosis	Pubtator	26472821	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	BEFREE	30343009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	20861460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10747292, 9690558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	3112156	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11151060, 28640257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26427914, 28640257, 30670049, 8813954	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	9436918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation, type 2C	Congenital disorder of glycosylation	BEFREE	8710783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29036563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic neutropenia	Pubtator	11133754	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	10571016, 17944600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	10374873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	39888143	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial medullary thyroid carcinoma	Medullary thyroid carcinoma	BEFREE	7725748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	22771507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	27757838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	27757838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal carcinoma	Gastrointestinal carcinoma	BEFREE	19781661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21636707, 23319191, 24086629, 26578623, 30467961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23524267, 24086629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23524267, 24086629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23524267, 31104223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34170383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	24403049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	15882262	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease 0 Muscle	Glycogen storage disease	Pubtator	16126871	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	16867159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	10029454, 10494126, 12149227, 14585370, 1716042, 17510532, 1849760, 18647967, 2173409, 21859738, 22367293, 29950528, 36032657, 8380728, 8386441, 9327746 View all (1 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11372737, 12670918, 1384376, 2297052, 29742695, 30350336, 8605360, 9490693, 9707610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	1987769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	7835953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	37798282	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	33441404	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	33441404	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	12393641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	9490693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	10936782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10873613, 12370411, 14533803, 16418266, 31097000, 3118100, 7949657, 8795692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	12599181, 1378322, 2568858, 33301193, 8093344, 8556956	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	16418266, 28718379	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11473459, 12717686, 17488160, 18061959, 18085638, 28718379, 30809981, 32218491, 33794295	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	15114596, 21148082, 33301193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10329918, 15746035, 16418266, 18061959, 21812014, 24441947, 24953795, 27400753, 31097000, 31209266, 31568521, 8795692, 9858225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	18085638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	12393641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	14533803, 9070245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukocyte-Adhesion Deficiency Syndrome	Leukocyte adhesion deficiency	BEFREE	10419878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15123238, 17054948, 24232099, 7685236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	26472821	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	32983107	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	12370411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	1675497, 32948132	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	12029441	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphocyte Rich Classical Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	23073322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	21435201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	1987769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Extranodal NK-T-Cell	Lymphoma	BEFREE	26497849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	30393962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Mesothelioma of Peritoneum	Peritoneal mesothelioma	BEFREE	29048219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20231016, 22025563, 23887626, 23959823, 26701615, 27375041, 28692034, 29685380, 30941952, 31054033, 31839366, 9663428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	23797812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10449611, 26636541, 31104223, 8542587, 9133454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25733690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14601054, 20833389, 25967142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27757838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30372804, 30867744, 31706102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14601054, 14686931, 15141079, 15229399, 17695536, 18690645, 20085584, 22287018, 23341539, 23797812, 23887626, 23959823, 24953560, 26094873, 26636541 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20460514, 25213663, 9690558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mediastinal (Thymic) Large B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	16224207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	7725748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	19185848, 22411914, 23592496, 25921740, 26938241, 30657775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	22411914, 23135025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12370411, 25672851, 26094873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	31961483, 33589521	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	29048219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	12194995	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	15334545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia	Multiple Endocrine Neoplasia	BEFREE	7725748		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	12393641, 21229640, 21635204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	12393641, 21635204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	12399973, 12591277, 17662271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	LHGDN	17662271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29746525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	31240830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	29809052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	29135655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11165714, 12370411, 15031530, 17695536, 18023290, 19185848, 20824144, 21327325, 21365246, 21857669, 22287018, 2322103, 23865520, 24953795, 26094873 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	9484784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	29051534	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	26521232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10449611, 19572148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	28817210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	38343056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	1931612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	10359820, 23446997, 24741628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	31428052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	28332730, 29381839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	30298790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	10374873, 1375531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	10374873, 11520279, 12764373, 16707593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	16707593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	11520279, 30683310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14601054, 20833389, 25967142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	14601054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25967142	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	15882262	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	12393641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	26546613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	8679447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29809052		★★★★★ ★☆☆☆☆ Found in Text Mining only
SPINAL MUSCULAR ATROPHY WITH RESPIRATORY DISTRESS 1	SPINAL MUSCULAR ATROPHY WITH RESPIRATORY DISTRESS	BEFREE	31445043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22799384, 28425129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23797812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28681122	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28681122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29700216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27757838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27757838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	36111748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	22367293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer follicular	Follicular thyroid cancer	Pubtator	27550342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	34638800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	27550342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	27550342	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	27550342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	27550342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	26137907, 28666720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	21473743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	30372804, 34350945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	19369244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	31519925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FUT4 (fucosyltransferase 4)