FUT3 (fucosyltransferase 3 (Lewis blood group))

Gene

• Entrez ID: 2525
• Gene name: Fucosyltransferase 3 (Lewis blood group)
• Gene symbol: FUT3
• Synonyms (NCBI Gene): CD174, FT3B, FucT-III, LE, Les
• Chromosome: 19
• Chromosome location: 19p13.3
• Summary: The Lewis histo-blood group system comprises a set of fucosylated glycosphingolipids that are synthesized by exocrine epithelial cells and circulate in body fluids. The glycosphingolipids function in embryogenesis, tissue differentiation, tumor metastasis

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1006558	hsa-miR-1245b-3p	CLIP-seq
MIRT1006559	hsa-miR-125a-3p	CLIP-seq
MIRT1006560	hsa-miR-3180-5p	CLIP-seq
MIRT1006561	hsa-miR-3665	CLIP-seq
MIRT1006562	hsa-miR-4316	CLIP-seq
MIRT1006563	hsa-miR-4514	CLIP-seq
MIRT1006564	hsa-miR-4645-5p	CLIP-seq
MIRT1006565	hsa-miR-4673	CLIP-seq
MIRT1006566	hsa-miR-4692	CLIP-seq
MIRT1006567	hsa-miR-4705	CLIP-seq
MIRT1006568	hsa-miR-4710	CLIP-seq
MIRT1006569	hsa-miR-4729	CLIP-seq
MIRT1006570	hsa-miR-4777-3p	CLIP-seq
MIRT1006571	hsa-miR-520a-5p	CLIP-seq
MIRT1006572	hsa-miR-525-5p	CLIP-seq
MIRT1006573	hsa-miR-582-5p	CLIP-seq
MIRT1006560	hsa-miR-3180-5p	CLIP-seq
MIRT1006569	hsa-miR-4729	CLIP-seq
MIRT1006571	hsa-miR-520a-5p	CLIP-seq
MIRT1006572	hsa-miR-525-5p	CLIP-seq
MIRT1006573	hsa-miR-582-5p	CLIP-seq
MIRT1006560	hsa-miR-3180-5p	CLIP-seq
MIRT1006569	hsa-miR-4729	CLIP-seq
MIRT1006571	hsa-miR-520a-5p	CLIP-seq
MIRT1006572	hsa-miR-525-5p	CLIP-seq
MIRT1006573	hsa-miR-582-5p	CLIP-seq
MIRT1006560	hsa-miR-3180-5p	CLIP-seq
MIRT1006569	hsa-miR-4729	CLIP-seq
MIRT1006571	hsa-miR-520a-5p	CLIP-seq
MIRT1006572	hsa-miR-525-5p	CLIP-seq
MIRT1006573	hsa-miR-582-5p	CLIP-seq
MIRT2231916	hsa-miR-106a	CLIP-seq
MIRT2231917	hsa-miR-106b	CLIP-seq
MIRT2231918	hsa-miR-150	CLIP-seq
MIRT2231919	hsa-miR-17	CLIP-seq
MIRT2231920	hsa-miR-20a	CLIP-seq
MIRT2231921	hsa-miR-20b	CLIP-seq
MIRT2231922	hsa-miR-302a	CLIP-seq
MIRT2231923	hsa-miR-302b	CLIP-seq
MIRT2231924	hsa-miR-302c	CLIP-seq
MIRT2231925	hsa-miR-302d	CLIP-seq
MIRT2231926	hsa-miR-302e	CLIP-seq
MIRT2231927	hsa-miR-372	CLIP-seq
MIRT2231928	hsa-miR-373	CLIP-seq
MIRT2231929	hsa-miR-512-3p	CLIP-seq
MIRT2231930	hsa-miR-519d	CLIP-seq
MIRT2231931	hsa-miR-520a-3p	CLIP-seq
MIRT2231932	hsa-miR-520b	CLIP-seq
MIRT2231933	hsa-miR-520c-3p	CLIP-seq
MIRT2231934	hsa-miR-520d-3p	CLIP-seq
MIRT2231935	hsa-miR-520e	CLIP-seq
MIRT2231936	hsa-miR-520g	CLIP-seq
MIRT2231937	hsa-miR-520h	CLIP-seq
MIRT2231938	hsa-miR-93	CLIP-seq
MIRT2449940	hsa-miR-1256	CLIP-seq
MIRT2449941	hsa-miR-3674	CLIP-seq
MIRT2449942	hsa-miR-4642	CLIP-seq
MIRT2449940	hsa-miR-1256	CLIP-seq
MIRT2449941	hsa-miR-3674	CLIP-seq
MIRT2449942	hsa-miR-4642	CLIP-seq
MIRT2449940	hsa-miR-1256	CLIP-seq
MIRT2449941	hsa-miR-3674	CLIP-seq
MIRT2449942	hsa-miR-4642	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MYC	Activation	22547830

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0005515	Function	Protein binding	IPI	32296183, 33961781
GO:0005794	Component	Golgi apparatus	IEA
GO:0006486	Process	Protein glycosylation	IEA
GO:0006487	Process	Protein N-linked glycosylation	IDA	29593094
GO:0006493	Process	Protein O-linked glycosylation	IDA	29593094
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006665	Process	Sphingolipid metabolic process	IEA
GO:0006672	Process	Ceramide metabolic process	IDA	7721776, 12668675
GO:0008417	Function	Fucosyltransferase activity	IDA	7721776, 12668675
GO:0008417	Function	Fucosyltransferase activity	IEA
GO:0009311	Process	Oligosaccharide metabolic process	IDA	1740457
GO:0009312	Process	Oligosaccharide biosynthetic process	IDA	1977660
GO:0009312	Process	Oligosaccharide biosynthetic process	IEA
GO:0009312	Process	Oligosaccharide biosynthetic process	TAS
GO:0009988	Process	Cell-cell recognition	IC	12668675
GO:0016020	Component	Membrane	IDA	1977660
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0017060	Function	3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity	IDA	1740457, 1977660, 7721776
GO:0017060	Function	3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity	IEA
GO:0017060	Function	3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity	IMP	10211701, 11058871
GO:0017060	Function	3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity	TAS
GO:0017083	Function	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IDA	1740457, 1977660, 7721776, 12668675, 29593094
GO:0017083	Function	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IEA
GO:0017083	Function	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IMP	10211701, 11058871
GO:0022409	Process	Positive regulation of cell-cell adhesion	IMP	11058871
GO:0030334	Process	Regulation of cell migration	IMP	27453266
GO:0032580	Component	Golgi cisterna membrane	IEA
GO:0036065	Process	Fucosylation	IBA
GO:0036065	Process	Fucosylation	IDA	1977660
GO:0042127	Process	Regulation of cell population proliferation	IMP	27453266
GO:0043413	Process	Macromolecule glycosylation	IDA	1977660, 12668675
GO:0046920	Function	Alpha-(1->3)-fucosyltransferase activity	IBA
GO:0046920	Function	Alpha-(1->3)-fucosyltransferase activity	IDA	1977660
GO:0046920	Function	Alpha-(1->3)-fucosyltransferase activity	TAS
GO:0070062	Component	Extracellular exosome	HDA	19199708

Other IDs

• MIM: 111100
• HGNC: 4014
• e!Ensembl: ENSG00000171124

Protein

• UniProt ID: P21217
• Protein name: 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase FUT3 (EC 2.4.1.65) (4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase) (EC 2.4.1.152) (Alpha-3-fucosyltransferase FUT3) (EC 2.4.1.-) (Blood group Lewis alpha-4-fucosyltransferas
• Protein function: Catalyzes the transfer of L-fucose, from a guanosine diphosphate-beta-L-fucose, to both the subterminal N-acetyl glucosamine (GlcNAc) of type 1 chain (beta-D-Gal-(1->3)-beta-D-GlcNAc) glycolipids and oligosaccharides via an alpha(1,4) linkage, a
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF17039	Glyco_tran_10_N	60 → 170	Fucosyltransferase, N-terminal	Domain
  PF00852	Glyco_transf_10	189 → 360	Glycosyltransferase family 10 (fucosyltransferase) C-term	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in stomach, colon, small intestine, lung and kidney and to a lesser extent in salivary gland, bladder, uterus and liver. {ECO:0000269|PubMed:7650030}.
• Sequence:

  MDPLGAAKPQWPWRRCLAALLFQLLVAVCFFSYLRVSRDDATGSPRAPSGSSRQDTTPTR
  PTLLILLWTWPFHIPVALSRCSEMVPGTADCHITADRKVYPQADTVIVHHWDIMSNPKSR
  LPPSPRPQGQRWIWFNLEPPPNCQHLEALDRYFNLTMSYRSDSDIFTPYGWLEPWSGQPA
  HPPLNLSAKTELVAWAVSNWKPDSARVRYYQSLQAHLKVDVYGRSHKPLPKGTMMETLSR
  YKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPK
  DLARYLQELDKDHARYLSYFRWRETLRPRSFSWALDFCKACWKLQQESRYQTVRSIAAWF
  T

• Sequence length: 361

Pathways

KEGG:

Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways

Reactome:

Lewis blood group biosynthesis
Reactions specific to the complex N-glycan synthesis pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHOLELITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEFICIENCY ANEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FUT3-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY FIBROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitamin B12 deficiency	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	30589515		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26423071		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	15942212		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	30591490		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31676359		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30767212		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30767212		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	30292023		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26321244		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	34936845	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	21437888		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21437888		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31676359, 37342060	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31860772	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35955933	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	26321244		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	23958938		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	26766790		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	26766790	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	26766790	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16199102, 8909999		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	30589515	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	34936845	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24253505		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24253505, 35489554	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28977844		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	17383304		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	17383304		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	10072221, 10886491, 17383304	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	17383304		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	24720527		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	19169360, 23951065		★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	BEFREE	31012870		★☆☆☆☆ Found in Text Mining only
dopamine beta hydroxylase deficiency		Pubtator	10886491	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Achalasia	Achalasia	BEFREE	29439587, 29915812, 30153516, 30957312		★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	30225741, 31848870		★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	29307652, 29439587, 29915812, 31214803, 31451984		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	31000730	Associate	★☆☆☆☆ Found in Text Mining only
Hiatal Hernia	Hiatal Hernia	BEFREE	30225741		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	34172473	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immunoglobulin A deficiency (disorder)	Immunoglobulin A deficiency	BEFREE	26454189		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	32764781	Associate	★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	26321244		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	18205178		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21437888	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	30292023		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26321244		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21437888		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28267695		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20833389		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24947433		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24253505		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	30929162		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18205178, 21437888, 26321244, 26908442, 27038681, 30929162		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	31000730	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29850522		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	29850522	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28267695		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	1931612	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	31000730	Associate	★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	23958938		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20833389		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20833389	Associate	★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	21437888		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	21437888		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	21437888	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24947433		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29143776	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	31000730	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	26766790		★☆☆☆☆ Found in Text Mining only