Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2519
Gene name	Alpha-L-fucosidase 2
Gene symbol	FUCA2
Synonyms (NCBI Gene)	dJ20N2.5
Chromosome	6
Chromosome location	6q24.2
Summary	This gene encodes a plasma alpha-L-fucosidase, which represents 10-20% of the total cellular fucosidase activity. The protein is a member of the glycosyl hydrolase 29 family, and catalyzes the hydrolysis of the alpha-1,6-linked fucose joined to the reduci

119

Show/Hide all (119)

miRTarBase ID	miRNA	Experiments
MIRT1006115	hsa-miR-103a	CLIP-seq
MIRT1006116	hsa-miR-106a	CLIP-seq
MIRT1006117	hsa-miR-106b	CLIP-seq
MIRT1006118	hsa-miR-107	CLIP-seq
MIRT1006119	hsa-miR-1276	CLIP-seq
MIRT1006120	hsa-miR-1301	CLIP-seq
MIRT1006121	hsa-miR-17	CLIP-seq
MIRT1006122	hsa-miR-185	CLIP-seq
MIRT1006123	hsa-miR-20a	CLIP-seq
MIRT1006124	hsa-miR-20b	CLIP-seq
MIRT1006125	hsa-miR-3614-3p	CLIP-seq
MIRT1006126	hsa-miR-3662	CLIP-seq
MIRT1006127	hsa-miR-384	CLIP-seq
MIRT1006128	hsa-miR-409-5p	CLIP-seq
MIRT1006129	hsa-miR-4306	CLIP-seq
MIRT1006130	hsa-miR-4424	CLIP-seq
MIRT1006131	hsa-miR-4470	CLIP-seq
MIRT1006132	hsa-miR-4644	CLIP-seq
MIRT1006133	hsa-miR-4666-5p	CLIP-seq
MIRT1006134	hsa-miR-4802-3p	CLIP-seq
MIRT1006135	hsa-miR-502-5p	CLIP-seq
MIRT1006136	hsa-miR-5047	CLIP-seq
MIRT1006137	hsa-miR-519a	CLIP-seq
MIRT1006138	hsa-miR-519b-3p	CLIP-seq
MIRT1006139	hsa-miR-519c-3p	CLIP-seq
MIRT1006140	hsa-miR-519d	CLIP-seq
MIRT1006141	hsa-miR-520d-5p	CLIP-seq
MIRT1006142	hsa-miR-520g	CLIP-seq
MIRT1006143	hsa-miR-520h	CLIP-seq
MIRT1006144	hsa-miR-522	CLIP-seq
MIRT1006145	hsa-miR-524-5p	CLIP-seq
MIRT1006146	hsa-miR-556-3p	CLIP-seq
MIRT1006147	hsa-miR-595	CLIP-seq
MIRT1006148	hsa-miR-93	CLIP-seq
MIRT1998127	hsa-miR-136	CLIP-seq
MIRT1998128	hsa-miR-145	CLIP-seq
MIRT1998129	hsa-miR-221	CLIP-seq
MIRT1998130	hsa-miR-222	CLIP-seq
MIRT1998131	hsa-miR-3160-5p	CLIP-seq
MIRT1998132	hsa-miR-4328	CLIP-seq
MIRT1998133	hsa-miR-4716-5p	CLIP-seq
MIRT1998134	hsa-miR-515-5p	CLIP-seq
MIRT1998135	hsa-miR-548v	CLIP-seq
MIRT1006116	hsa-miR-106a	CLIP-seq
MIRT1006117	hsa-miR-106b	CLIP-seq
MIRT2231771	hsa-miR-1245b-5p	CLIP-seq
MIRT1998128	hsa-miR-145	CLIP-seq
MIRT1006121	hsa-miR-17	CLIP-seq
MIRT2231772	hsa-miR-181a	CLIP-seq
MIRT2231773	hsa-miR-181b	CLIP-seq
MIRT2231774	hsa-miR-181c	CLIP-seq
MIRT2231775	hsa-miR-181d	CLIP-seq
MIRT1006122	hsa-miR-185	CLIP-seq
MIRT2231776	hsa-miR-1910	CLIP-seq
MIRT2231777	hsa-miR-1912	CLIP-seq
MIRT1006123	hsa-miR-20a	CLIP-seq
MIRT1006124	hsa-miR-20b	CLIP-seq
MIRT2231778	hsa-miR-23a	CLIP-seq
MIRT2231779	hsa-miR-23b	CLIP-seq
MIRT2231780	hsa-miR-23c	CLIP-seq
MIRT2231781	hsa-miR-302a	CLIP-seq
MIRT2231782	hsa-miR-302b	CLIP-seq
MIRT2231783	hsa-miR-302c	CLIP-seq
MIRT2231784	hsa-miR-302d	CLIP-seq
MIRT2231785	hsa-miR-302e	CLIP-seq
MIRT2231786	hsa-miR-3142	CLIP-seq
MIRT1006126	hsa-miR-3662	CLIP-seq
MIRT2231787	hsa-miR-371b-3p	CLIP-seq
MIRT2231788	hsa-miR-372	CLIP-seq
MIRT2231789	hsa-miR-373	CLIP-seq
MIRT1006128	hsa-miR-409-5p	CLIP-seq
MIRT2231790	hsa-miR-4262	CLIP-seq
MIRT1006129	hsa-miR-4306	CLIP-seq
MIRT1006130	hsa-miR-4424	CLIP-seq
MIRT1006131	hsa-miR-4470	CLIP-seq
MIRT1006132	hsa-miR-4644	CLIP-seq
MIRT1006133	hsa-miR-4666-5p	CLIP-seq
MIRT1006134	hsa-miR-4802-3p	CLIP-seq
MIRT2231791	hsa-miR-486-5p	CLIP-seq
MIRT1006137	hsa-miR-519a	CLIP-seq
MIRT1006138	hsa-miR-519b-3p	CLIP-seq
MIRT1006139	hsa-miR-519c-3p	CLIP-seq
MIRT1006140	hsa-miR-519d	CLIP-seq
MIRT2231792	hsa-miR-520a-3p	CLIP-seq
MIRT2231793	hsa-miR-520b	CLIP-seq
MIRT2231794	hsa-miR-520c-3p	CLIP-seq
MIRT2231795	hsa-miR-520d-3p	CLIP-seq
MIRT2231796	hsa-miR-520e	CLIP-seq
MIRT1006142	hsa-miR-520g	CLIP-seq
MIRT1006143	hsa-miR-520h	CLIP-seq
MIRT1006144	hsa-miR-522	CLIP-seq
MIRT2231797	hsa-miR-555	CLIP-seq
MIRT2231798	hsa-miR-676	CLIP-seq
MIRT2231799	hsa-miR-891b	CLIP-seq
MIRT1006148	hsa-miR-93	CLIP-seq
MIRT1998128	hsa-miR-145	CLIP-seq
MIRT2231776	hsa-miR-1910	CLIP-seq
MIRT2231777	hsa-miR-1912	CLIP-seq
MIRT2231791	hsa-miR-486-5p	CLIP-seq
MIRT2231799	hsa-miR-891b	CLIP-seq
MIRT1998128	hsa-miR-145	CLIP-seq
MIRT2231776	hsa-miR-1910	CLIP-seq
MIRT2231777	hsa-miR-1912	CLIP-seq
MIRT2231799	hsa-miR-891b	CLIP-seq
MIRT1998128	hsa-miR-145	CLIP-seq
MIRT2231776	hsa-miR-1910	CLIP-seq
MIRT2231777	hsa-miR-1912	CLIP-seq
MIRT2231791	hsa-miR-486-5p	CLIP-seq
MIRT2231799	hsa-miR-891b	CLIP-seq
MIRT1998128	hsa-miR-145	CLIP-seq
MIRT2231776	hsa-miR-1910	CLIP-seq
MIRT2231777	hsa-miR-1912	CLIP-seq
MIRT2231791	hsa-miR-486-5p	CLIP-seq
MIRT2231799	hsa-miR-891b	CLIP-seq
MIRT1998127	hsa-miR-136	CLIP-seq
MIRT1998128	hsa-miR-145	CLIP-seq
MIRT1998132	hsa-miR-4328	CLIP-seq
MIRT2681226	hsa-miR-4775	CLIP-seq
MIRT2681227	hsa-miR-590-3p	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004560	Function	Alpha-L-fucosidase activity	IBA
GO:0004560	Function	Alpha-L-fucosidase activity	IDA	19666478
GO:0004560	Function	Alpha-L-fucosidase activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	19666478
GO:0005764	Component	Lysosome	IBA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005975	Process	Carbohydrate metabolic process	IEA
GO:0006004	Process	Fucose metabolic process	IBA
GO:0006004	Process	Fucose metabolic process	IDA	19666478
GO:0006004	Process	Fucose metabolic process	IEA
GO:0009617	Process	Response to bacterium	IMP	19666478
GO:0016139	Process	Glycoside catabolic process	IBA
GO:0016139	Process	Glycoside catabolic process	IDA	19666478
GO:0016139	Process	Glycoside catabolic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016798	Function	Hydrolase activity, acting on glycosyl bonds	IEA
GO:0035578	Component	Azurophil granule lumen	IEA
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:2000535	Process	Regulation of entry of bacterium into host cell	IMP	19666478

MIM	HGNC	e!Ensembl
136820	4008	ENSG00000001036

Q9BTY2

Protein name

Plasma alpha-L-fucosidase (EC 3.2.1.51) (Alpha-L-fucoside fucohydrolase 2) (Alpha-L-fucosidase 2)

Protein function

Alpha-L-fucosidase is responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01120	Alpha_L_fucos	24 → 365	Alpha-L-fucosidase	Domain
PF16757	Fucosidase_C	376 → 464	Alpha-L-fucosidase C-terminal domain	Domain

Sequence

MRPQELPRLAFPLLLLLLLLLPPPPCPAHSATRFDPTWESLDARQLPAWFDQAKFGIFIH
WGVFSVPSFGSEWFWWYWQKEKIPKYVEFMKDNYPPSFKYEDFGPLFTAKFFNANQWADI
FQASGAKYIVLTSKHHEGFTLWGSEYSWNWNAIDEGPKRDIVKELEVAIRNRTDLRFGLY
YSLFEWFHPLFLEDESSSFHKRQFPVSKTLPELYELVNNYQPEVLWSDGDGGAPDQYWNS
TGFLAWLYNESPVRGTVVTNDRWGAGSICKHGGFYTCSDRYNPGHLLPHKWENCMTIDKL
SWGYRREAGISDYLTIEELVKQLVETVSCGGNLLMNIGPTLDGTISVVFEERLRQMGSWL
KVNGEAIYETHTWRSQNDTVTPDVWYTSKPKEKLVYAIFLKWPTSGQLFLGHPKAILGAT
EVKLLGHGQPLNWISLEQNGIMVELPQLTIHQMPCKWGWALALTNVI

Sequence length

467

Interactions

View interactions

	KEGG		Reactome
	Other glycan degradation Lysosome		Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) Neutrophil degranulation Post-translational protein phosphorylation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
High myopia	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE MYOPIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anemia, Sickle Cell	Anemia	BEFREE	27636371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28808940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	19666478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal ulcer	Pubtator	19666478	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fucosidase Deficiency Disease	Fucosidase Deficiency Disease	BEFREE	31531202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34745134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucolipidoses	Mucolipidosis	BEFREE	3997153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	27773385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19666478, 36583336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FUCA2 (alpha-L-fucosidase 2)