ABL1 (ABL proto-oncogene 1, non-receptor tyrosine kinase)

Gene

• Entrez ID: 25
• Gene name: ABL proto-oncogene 1, non-receptor tyrosine kinase
• Gene symbol: ABL1
• Synonyms (NCBI Gene): ABL, BCR-ABL, CHDSKM, JTK7, bcr/abl, c-ABL, c-ABL1, p150, v-abl
• Chromosome: 9
• Chromosome location: 9q34.12
• Summary: This gene is a protooncogene that encodes a protein tyrosine kinase involved in a variety of cellular processes, including cell division, adhesion, differentiation, and response to stress. The activity of the protein is negatively regulated by its SH3 dom

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs121913448	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs121913449	A>T	Likely-pathogenic	Coding sequence variant, missense variant
rs121913450	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs121913451	C>A,G	Likely-pathogenic	Coding sequence variant, missense variant
rs121913452	T>A,C,G	Likely-pathogenic	Coding sequence variant, missense variant
rs121913453	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs121913454	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs121913455	C>G	Likely-pathogenic	Coding sequence variant, missense variant
rs121913456	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs121913457	T>C	Pathogenic-likely-pathogenic	Coding sequence variant, missense variant
rs121913458	G>C,T	Likely-pathogenic	Coding sequence variant, missense variant
rs121913459	C>T	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs121913460	A>T	Likely-pathogenic	Coding sequence variant, missense variant
rs121913461	T>C	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs137853304	T>C	Pathogenic	Coding sequence variant, missense variant
rs387906516	A>T	Pathogenic	Missense variant, coding sequence variant
rs387906517	G>A	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs1057519758	T>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1057519771	G>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1057519772	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1057519773	T>A,C,G	Likely-pathogenic, not-provided	Coding sequence variant, missense variant
rs1057519774	T>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1057519775	T>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1060499547	A>G	Pathogenic	Coding sequence variant, missense variant
rs1060499548	G>A	Pathogenic	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003032	hsa-miR-203a-3p	Luciferase reporter assay	18538733
MIRT003032	hsa-miR-203a-3p	Luciferase reporter assay	18538733
MIRT003032	hsa-miR-203a-3p	Luciferase reporter assay	18538733
MIRT003032	hsa-miR-203a-3p	Review	20029422
MIRT007197	hsa-miR-29a-3p	Luciferase reporter assay	23428668
MIRT007197	hsa-miR-29a-3p	Luciferase reporter assay	23428668
MIRT007359	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR	23287430
MIRT007359	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR	23287430
MIRT007359	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR	23287430
MIRT051948	hsa-let-7b-5p	CLASH	23622248
MIRT046104	hsa-miR-125b-5p	CLASH	23622248
MIRT045402	hsa-miR-149-5p	CLASH	23622248
MIRT045402	hsa-miR-149-5p	CLASH	23622248
MIRT043695	hsa-miR-342-3p	CLASH	23622248
MIRT042250	hsa-miR-484	CLASH	23622248
MIRT053063	hsa-miR-4723-5p	Flow, Immunohistochemistry, Luciferase reporter assay, Western blot	24223753
MIRT003032	hsa-miR-203a-3p	Immunoprecipitaion, qRT-PCR, Western blot	23462723
MIRT003032	hsa-miR-203a-3p	qRT-PCR, Western blot	23968727
MIRT003032	hsa-miR-203a-3p	qRT-PCR, Western blot	23968727
MIRT489653	hsa-miR-3173-3p	PAR-CLIP	20371350
MIRT489652	hsa-miR-6891-5p	PAR-CLIP	20371350
MIRT489651	hsa-miR-4695-5p	PAR-CLIP	20371350
MIRT489650	hsa-miR-4779	PAR-CLIP	20371350
MIRT489648	hsa-miR-5008-5p	PAR-CLIP	20371350
MIRT489649	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT489647	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT489646	hsa-miR-765	PAR-CLIP	20371350
MIRT489645	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT489644	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT053063	hsa-miR-4723-5p	PAR-CLIP	20371350
MIRT489643	hsa-miR-5698	PAR-CLIP	20371350
MIRT489642	hsa-miR-6870-5p	PAR-CLIP	20371350
MIRT489640	hsa-miR-7111-5p	PAR-CLIP	20371350
MIRT489653	hsa-miR-3173-3p	PAR-CLIP	23592263
MIRT489652	hsa-miR-6891-5p	PAR-CLIP	23592263
MIRT489651	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT489650	hsa-miR-4779	PAR-CLIP	23592263
MIRT489648	hsa-miR-5008-5p	PAR-CLIP	23592263
MIRT489649	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT489647	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT489646	hsa-miR-765	PAR-CLIP	23592263
MIRT489645	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT489644	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT053063	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT489643	hsa-miR-5698	PAR-CLIP	23592263
MIRT489642	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT489640	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT227788	hsa-miR-583	PAR-CLIP	23592263
MIRT458704	hsa-miR-548b-3p	PAR-CLIP	23592263
MIRT458703	hsa-miR-4511	PAR-CLIP	23592263
MIRT227790	hsa-miR-7854-3p	PAR-CLIP	23592263
MIRT227789	hsa-miR-1537-5p	PAR-CLIP	23592263
MIRT458702	hsa-miR-4718	PAR-CLIP	23592263
MIRT458701	hsa-miR-4999-5p	PAR-CLIP	23592263
MIRT441301	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT441301	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT489653	hsa-miR-3173-3p	PAR-CLIP	26701625
MIRT489649	hsa-miR-3184-5p	PAR-CLIP	26701625
MIRT489647	hsa-miR-423-5p	PAR-CLIP	26701625
MIRT489651	hsa-miR-4695-5p	PAR-CLIP	26701625
MIRT053063	hsa-miR-4723-5p	PAR-CLIP	26701625
MIRT489650	hsa-miR-4779	PAR-CLIP	26701625
MIRT489648	hsa-miR-5008-5p	PAR-CLIP	26701625
MIRT489643	hsa-miR-5698	PAR-CLIP	26701625
MIRT489644	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT489642	hsa-miR-6870-5p	PAR-CLIP	26701625
MIRT489652	hsa-miR-6891-5p	PAR-CLIP	26701625
MIRT489645	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT489640	hsa-miR-7111-5p	PAR-CLIP	26701625
MIRT489646	hsa-miR-765	PAR-CLIP	26701625
MIRT489653	hsa-miR-3173-3p	PAR-CLIP	20371350
MIRT489652	hsa-miR-6891-5p	PAR-CLIP	20371350
MIRT489651	hsa-miR-4695-5p	PAR-CLIP	20371350
MIRT489650	hsa-miR-4779	PAR-CLIP	20371350
MIRT489648	hsa-miR-5008-5p	PAR-CLIP	20371350
MIRT489649	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT489647	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT489646	hsa-miR-765	PAR-CLIP	20371350
MIRT489645	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT489644	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT053063	hsa-miR-4723-5p	PAR-CLIP	20371350
MIRT489643	hsa-miR-5698	PAR-CLIP	20371350
MIRT489642	hsa-miR-6870-5p	PAR-CLIP	20371350
MIRT489640	hsa-miR-7111-5p	PAR-CLIP	20371350
MIRT489653	hsa-miR-3173-3p	PAR-CLIP	23592263
MIRT489652	hsa-miR-6891-5p	PAR-CLIP	23592263
MIRT489651	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT489650	hsa-miR-4779	PAR-CLIP	23592263
MIRT489648	hsa-miR-5008-5p	PAR-CLIP	23592263
MIRT489649	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT489647	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT489646	hsa-miR-765	PAR-CLIP	23592263
MIRT489645	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT489644	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT053063	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT489643	hsa-miR-5698	PAR-CLIP	23592263
MIRT489642	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT489640	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT227788	hsa-miR-583	PAR-CLIP	23592263
MIRT458704	hsa-miR-548b-3p	PAR-CLIP	23592263
MIRT458703	hsa-miR-4511	PAR-CLIP	23592263
MIRT227790	hsa-miR-7854-3p	PAR-CLIP	23592263
MIRT227789	hsa-miR-1537-5p	PAR-CLIP	23592263
MIRT458702	hsa-miR-4718	PAR-CLIP	23592263
MIRT458701	hsa-miR-4999-5p	PAR-CLIP	23592263
MIRT760530	hsa-miR-1202	CLIP-seq
MIRT760531	hsa-miR-1207-5p	CLIP-seq
MIRT760532	hsa-miR-1275	CLIP-seq
MIRT760533	hsa-miR-128	CLIP-seq
MIRT760534	hsa-miR-1285	CLIP-seq
MIRT760535	hsa-miR-1286	CLIP-seq
MIRT760536	hsa-miR-140-3p	CLIP-seq
MIRT760537	hsa-miR-141	CLIP-seq
MIRT760538	hsa-miR-1470	CLIP-seq
MIRT760539	hsa-miR-1912	CLIP-seq
MIRT760540	hsa-miR-1914	CLIP-seq
MIRT760541	hsa-miR-200a	CLIP-seq
MIRT760542	hsa-miR-27a	CLIP-seq
MIRT760543	hsa-miR-27b	CLIP-seq
MIRT760544	hsa-miR-296-5p	CLIP-seq
MIRT760545	hsa-miR-3065-3p	CLIP-seq
MIRT760546	hsa-miR-30a	CLIP-seq
MIRT760547	hsa-miR-30b	CLIP-seq
MIRT760548	hsa-miR-30c	CLIP-seq
MIRT760549	hsa-miR-30d	CLIP-seq
MIRT760550	hsa-miR-30e	CLIP-seq
MIRT760551	hsa-miR-3125	CLIP-seq
MIRT760552	hsa-miR-3127-5p	CLIP-seq
MIRT760553	hsa-miR-3157-5p	CLIP-seq
MIRT760554	hsa-miR-3160-5p	CLIP-seq
MIRT760555	hsa-miR-3187-5p	CLIP-seq
MIRT760556	hsa-miR-3202	CLIP-seq
MIRT760557	hsa-miR-326	CLIP-seq
MIRT760558	hsa-miR-330-5p	CLIP-seq
MIRT760559	hsa-miR-3617	CLIP-seq
MIRT760560	hsa-miR-3672	CLIP-seq
MIRT760561	hsa-miR-371-3p	CLIP-seq
MIRT760562	hsa-miR-371b-3p	CLIP-seq
MIRT760563	hsa-miR-378g	CLIP-seq
MIRT760564	hsa-miR-3916	CLIP-seq
MIRT760565	hsa-miR-3918	CLIP-seq
MIRT760566	hsa-miR-3922-5p	CLIP-seq
MIRT760567	hsa-miR-3972	CLIP-seq
MIRT760568	hsa-miR-4252	CLIP-seq
MIRT760569	hsa-miR-4271	CLIP-seq
MIRT760570	hsa-miR-4291	CLIP-seq
MIRT760571	hsa-miR-4436b-3p	CLIP-seq
MIRT760572	hsa-miR-4447	CLIP-seq
MIRT760573	hsa-miR-4469	CLIP-seq
MIRT760574	hsa-miR-4472	CLIP-seq
MIRT760575	hsa-miR-4476	CLIP-seq
MIRT760576	hsa-miR-4481	CLIP-seq
MIRT760577	hsa-miR-4486	CLIP-seq
MIRT760578	hsa-miR-4495	CLIP-seq
MIRT760579	hsa-miR-4496	CLIP-seq
MIRT760580	hsa-miR-4525	CLIP-seq
MIRT760581	hsa-miR-4635	CLIP-seq
MIRT760582	hsa-miR-4639-3p	CLIP-seq
MIRT760583	hsa-miR-4665-5p	CLIP-seq
MIRT760584	hsa-miR-4667-3p	CLIP-seq
MIRT760585	hsa-miR-4691-3p	CLIP-seq
MIRT760586	hsa-miR-4706	CLIP-seq
MIRT760587	hsa-miR-4716-3p	CLIP-seq
MIRT760588	hsa-miR-4725-3p	CLIP-seq
MIRT760589	hsa-miR-4728-5p	CLIP-seq
MIRT760590	hsa-miR-4737	CLIP-seq
MIRT760591	hsa-miR-4745-5p	CLIP-seq
MIRT760592	hsa-miR-4747-5p	CLIP-seq
MIRT760593	hsa-miR-4749-5p	CLIP-seq
MIRT760594	hsa-miR-4755-3p	CLIP-seq
MIRT760595	hsa-miR-4763-3p	CLIP-seq
MIRT760596	hsa-miR-4780	CLIP-seq
MIRT760597	hsa-miR-4787-5p	CLIP-seq
MIRT760598	hsa-miR-4797-5p	CLIP-seq
MIRT760599	hsa-miR-485-5p	CLIP-seq
MIRT760600	hsa-miR-486-3p	CLIP-seq
MIRT760601	hsa-miR-488	CLIP-seq
MIRT760602	hsa-miR-494	CLIP-seq
MIRT760603	hsa-miR-501-3p	CLIP-seq
MIRT760604	hsa-miR-502-3p	CLIP-seq
MIRT760605	hsa-miR-513a-5p	CLIP-seq
MIRT760606	hsa-miR-515-3p	CLIP-seq
MIRT760607	hsa-miR-519e	CLIP-seq
MIRT760608	hsa-miR-520a-5p	CLIP-seq
MIRT760609	hsa-miR-525-5p	CLIP-seq
MIRT760610	hsa-miR-526b	CLIP-seq
MIRT760611	hsa-miR-548ad	CLIP-seq
MIRT760612	hsa-miR-564	CLIP-seq
MIRT760613	hsa-miR-576-3p	CLIP-seq
MIRT760614	hsa-miR-578	CLIP-seq
MIRT760615	hsa-miR-604	CLIP-seq
MIRT760616	hsa-miR-612	CLIP-seq
MIRT760617	hsa-miR-623	CLIP-seq
MIRT760618	hsa-miR-625	CLIP-seq
MIRT760619	hsa-miR-641	CLIP-seq
MIRT760620	hsa-miR-939	CLIP-seq
MIRT1924221	hsa-miR-4457	CLIP-seq
MIRT1924222	hsa-miR-4731-3p	CLIP-seq
MIRT760597	hsa-miR-4787-5p	CLIP-seq
MIRT1924223	hsa-miR-4801	CLIP-seq
MIRT1924224	hsa-miR-642b	CLIP-seq
MIRT760530	hsa-miR-1202	CLIP-seq
MIRT1924225	hsa-miR-1224-3p	CLIP-seq
MIRT1924226	hsa-miR-1226	CLIP-seq
MIRT1924227	hsa-miR-1260	CLIP-seq
MIRT1924228	hsa-miR-1260b	CLIP-seq
MIRT760533	hsa-miR-128	CLIP-seq
MIRT1924229	hsa-miR-1280	CLIP-seq
MIRT1924230	hsa-miR-1293	CLIP-seq
MIRT1924231	hsa-miR-136	CLIP-seq
MIRT1924232	hsa-miR-148a	CLIP-seq
MIRT1924233	hsa-miR-148b	CLIP-seq
MIRT1924234	hsa-miR-152	CLIP-seq
MIRT1924235	hsa-miR-2682	CLIP-seq
MIRT760542	hsa-miR-27a	CLIP-seq
MIRT760543	hsa-miR-27b	CLIP-seq
MIRT1924236	hsa-miR-2861	CLIP-seq
MIRT1924237	hsa-miR-3120-5p	CLIP-seq
MIRT760551	hsa-miR-3125	CLIP-seq
MIRT760552	hsa-miR-3127-5p	CLIP-seq
MIRT1924238	hsa-miR-3138	CLIP-seq
MIRT1924239	hsa-miR-3144-5p	CLIP-seq
MIRT760554	hsa-miR-3160-5p	CLIP-seq
MIRT1924240	hsa-miR-3178	CLIP-seq
MIRT1924241	hsa-miR-3179	CLIP-seq
MIRT1924242	hsa-miR-3194-3p	CLIP-seq
MIRT760556	hsa-miR-3202	CLIP-seq
MIRT1924243	hsa-miR-361-5p	CLIP-seq
MIRT1924244	hsa-miR-3649	CLIP-seq
MIRT1924245	hsa-miR-3661	CLIP-seq
MIRT1924246	hsa-miR-3677-5p	CLIP-seq
MIRT1924247	hsa-miR-3688-3p	CLIP-seq
MIRT760561	hsa-miR-371-3p	CLIP-seq
MIRT760562	hsa-miR-371b-3p	CLIP-seq
MIRT760564	hsa-miR-3916	CLIP-seq
MIRT760566	hsa-miR-3922-5p	CLIP-seq
MIRT1924248	hsa-miR-3936	CLIP-seq
MIRT760567	hsa-miR-3972	CLIP-seq
MIRT1924249	hsa-miR-3978	CLIP-seq
MIRT1924221	hsa-miR-4457	CLIP-seq
MIRT1924250	hsa-miR-4475	CLIP-seq
MIRT760575	hsa-miR-4476	CLIP-seq
MIRT1924251	hsa-miR-4483	CLIP-seq
MIRT760579	hsa-miR-4496	CLIP-seq
MIRT1924252	hsa-miR-449c	CLIP-seq
MIRT1924253	hsa-miR-4514	CLIP-seq
MIRT1924254	hsa-miR-4520a-3p	CLIP-seq
MIRT760582	hsa-miR-4639-3p	CLIP-seq
MIRT1924255	hsa-miR-4649-5p	CLIP-seq
MIRT1924256	hsa-miR-4651	CLIP-seq
MIRT1924257	hsa-miR-4692	CLIP-seq
MIRT1924258	hsa-miR-4712-5p	CLIP-seq
MIRT1924259	hsa-miR-4713-5p	CLIP-seq
MIRT760592	hsa-miR-4747-5p	CLIP-seq
MIRT760594	hsa-miR-4755-3p	CLIP-seq
MIRT1924260	hsa-miR-4777-3p	CLIP-seq
MIRT760597	hsa-miR-4787-5p	CLIP-seq
MIRT1924261	hsa-miR-490-5p	CLIP-seq
MIRT1924262	hsa-miR-492	CLIP-seq
MIRT1924263	hsa-miR-495	CLIP-seq
MIRT760605	hsa-miR-513a-5p	CLIP-seq
MIRT1924264	hsa-miR-513b	CLIP-seq
MIRT760606	hsa-miR-515-3p	CLIP-seq
MIRT760607	hsa-miR-519e	CLIP-seq
MIRT760608	hsa-miR-520a-5p	CLIP-seq
MIRT760609	hsa-miR-525-5p	CLIP-seq
MIRT1924265	hsa-miR-532-3p	CLIP-seq
MIRT1924266	hsa-miR-541	CLIP-seq
MIRT760611	hsa-miR-548ad	CLIP-seq
MIRT760612	hsa-miR-564	CLIP-seq
MIRT760613	hsa-miR-576-3p	CLIP-seq
MIRT760614	hsa-miR-578	CLIP-seq
MIRT1924267	hsa-miR-608	CLIP-seq
MIRT1924268	hsa-miR-631	CLIP-seq
MIRT1924269	hsa-miR-654-5p	CLIP-seq
MIRT1924270	hsa-miR-770-5p	CLIP-seq
MIRT760530	hsa-miR-1202	CLIP-seq
MIRT2165551	hsa-miR-1205	CLIP-seq
MIRT760531	hsa-miR-1207-5p	CLIP-seq
MIRT2165552	hsa-miR-1234	CLIP-seq
MIRT2165553	hsa-miR-1253	CLIP-seq
MIRT2165554	hsa-miR-1266	CLIP-seq
MIRT760533	hsa-miR-128	CLIP-seq
MIRT760534	hsa-miR-1285	CLIP-seq
MIRT760535	hsa-miR-1286	CLIP-seq
MIRT1924230	hsa-miR-1293	CLIP-seq
MIRT1924231	hsa-miR-136	CLIP-seq
MIRT760536	hsa-miR-140-3p	CLIP-seq
MIRT760537	hsa-miR-141	CLIP-seq
MIRT2165555	hsa-miR-142-5p	CLIP-seq
MIRT1924232	hsa-miR-148a	CLIP-seq
MIRT1924233	hsa-miR-148b	CLIP-seq
MIRT1924234	hsa-miR-152	CLIP-seq
MIRT2165556	hsa-miR-1827	CLIP-seq
MIRT2165557	hsa-miR-1908	CLIP-seq
MIRT760539	hsa-miR-1912	CLIP-seq
MIRT760541	hsa-miR-200a	CLIP-seq
MIRT2165558	hsa-miR-203	CLIP-seq
MIRT2165559	hsa-miR-2114	CLIP-seq
MIRT2165560	hsa-miR-2467-3p	CLIP-seq
MIRT1924235	hsa-miR-2682	CLIP-seq
MIRT760542	hsa-miR-27a	CLIP-seq
MIRT760543	hsa-miR-27b	CLIP-seq
MIRT760545	hsa-miR-3065-3p	CLIP-seq
MIRT1924237	hsa-miR-3120-5p	CLIP-seq
MIRT2165561	hsa-miR-3126-3p	CLIP-seq
MIRT760552	hsa-miR-3127-5p	CLIP-seq
MIRT2165562	hsa-miR-3141	CLIP-seq
MIRT1924239	hsa-miR-3144-5p	CLIP-seq
MIRT760553	hsa-miR-3157-5p	CLIP-seq
MIRT2165563	hsa-miR-3158-3p	CLIP-seq
MIRT760554	hsa-miR-3160-5p	CLIP-seq
MIRT2165564	hsa-miR-3175	CLIP-seq
MIRT1924240	hsa-miR-3178	CLIP-seq
MIRT760555	hsa-miR-3187-5p	CLIP-seq
MIRT1924242	hsa-miR-3194-3p	CLIP-seq
MIRT760556	hsa-miR-3202	CLIP-seq
MIRT2165565	hsa-miR-331-3p	CLIP-seq
MIRT2165566	hsa-miR-3609	CLIP-seq
MIRT1924243	hsa-miR-361-5p	CLIP-seq
MIRT1924244	hsa-miR-3649	CLIP-seq
MIRT1924245	hsa-miR-3661	CLIP-seq
MIRT2165567	hsa-miR-3664-3p	CLIP-seq
MIRT760560	hsa-miR-3672	CLIP-seq
MIRT1924246	hsa-miR-3677-5p	CLIP-seq
MIRT760563	hsa-miR-378g	CLIP-seq
MIRT760565	hsa-miR-3918	CLIP-seq
MIRT760566	hsa-miR-3922-5p	CLIP-seq
MIRT760567	hsa-miR-3972	CLIP-seq
MIRT760568	hsa-miR-4252	CLIP-seq
MIRT2165568	hsa-miR-4270	CLIP-seq
MIRT2165569	hsa-miR-4287	CLIP-seq
MIRT760570	hsa-miR-4291	CLIP-seq
MIRT2165570	hsa-miR-431	CLIP-seq
MIRT2165571	hsa-miR-4312	CLIP-seq
MIRT2165572	hsa-miR-4426	CLIP-seq
MIRT2165573	hsa-miR-4434	CLIP-seq
MIRT760571	hsa-miR-4436b-3p	CLIP-seq
MIRT2165574	hsa-miR-4437	CLIP-seq
MIRT2165575	hsa-miR-4441	CLIP-seq
MIRT1924250	hsa-miR-4475	CLIP-seq
MIRT760575	hsa-miR-4476	CLIP-seq
MIRT1924251	hsa-miR-4483	CLIP-seq
MIRT760577	hsa-miR-4486	CLIP-seq
MIRT2165576	hsa-miR-4493	CLIP-seq
MIRT1924252	hsa-miR-449c	CLIP-seq
MIRT2165577	hsa-miR-4512	CLIP-seq
MIRT1924253	hsa-miR-4514	CLIP-seq
MIRT2165578	hsa-miR-4516	CLIP-seq
MIRT2165579	hsa-miR-4518	CLIP-seq
MIRT2165580	hsa-miR-4646-3p	CLIP-seq
MIRT2165581	hsa-miR-4647	CLIP-seq
MIRT1924255	hsa-miR-4649-5p	CLIP-seq
MIRT2165582	hsa-miR-4662b	CLIP-seq
MIRT2165583	hsa-miR-4672	CLIP-seq
MIRT2165584	hsa-miR-4674	CLIP-seq
MIRT2165585	hsa-miR-4685-3p	CLIP-seq
MIRT760585	hsa-miR-4691-3p	CLIP-seq
MIRT1924257	hsa-miR-4692	CLIP-seq
MIRT2165586	hsa-miR-4708-3p	CLIP-seq
MIRT1924258	hsa-miR-4712-5p	CLIP-seq
MIRT760592	hsa-miR-4747-5p	CLIP-seq
MIRT2165587	hsa-miR-4753-5p	CLIP-seq
MIRT760594	hsa-miR-4755-3p	CLIP-seq
MIRT2165588	hsa-miR-4761-5p	CLIP-seq
MIRT760595	hsa-miR-4763-3p	CLIP-seq
MIRT2165589	hsa-miR-4768-5p	CLIP-seq
MIRT1924260	hsa-miR-4777-3p	CLIP-seq
MIRT760596	hsa-miR-4780	CLIP-seq
MIRT760597	hsa-miR-4787-5p	CLIP-seq
MIRT760598	hsa-miR-4797-5p	CLIP-seq
MIRT2165590	hsa-miR-4798-3p	CLIP-seq
MIRT760599	hsa-miR-485-5p	CLIP-seq
MIRT760600	hsa-miR-486-3p	CLIP-seq
MIRT1924261	hsa-miR-490-5p	CLIP-seq
MIRT1924262	hsa-miR-492	CLIP-seq
MIRT760602	hsa-miR-494	CLIP-seq
MIRT1924263	hsa-miR-495	CLIP-seq
MIRT2165591	hsa-miR-499-3p	CLIP-seq
MIRT2165592	hsa-miR-499a-3p	CLIP-seq
MIRT760603	hsa-miR-501-3p	CLIP-seq
MIRT760604	hsa-miR-502-3p	CLIP-seq
MIRT760605	hsa-miR-513a-5p	CLIP-seq
MIRT1924266	hsa-miR-541	CLIP-seq
MIRT2165593	hsa-miR-542-5p	CLIP-seq
MIRT2165594	hsa-miR-548a-5p	CLIP-seq
MIRT2165595	hsa-miR-548ab	CLIP-seq
MIRT2165596	hsa-miR-548ah	CLIP-seq
MIRT2165597	hsa-miR-548ak	CLIP-seq
MIRT2165598	hsa-miR-548b-5p	CLIP-seq
MIRT2165599	hsa-miR-548c-5p	CLIP-seq
MIRT2165600	hsa-miR-548d-5p	CLIP-seq
MIRT2165601	hsa-miR-548h	CLIP-seq
MIRT2165602	hsa-miR-548i	CLIP-seq
MIRT2165603	hsa-miR-548j	CLIP-seq
MIRT2165604	hsa-miR-548k	CLIP-seq
MIRT2165605	hsa-miR-548l	CLIP-seq
MIRT2165606	hsa-miR-548t	CLIP-seq
MIRT2165607	hsa-miR-548w	CLIP-seq
MIRT2165608	hsa-miR-548y	CLIP-seq
MIRT2165609	hsa-miR-554	CLIP-seq
MIRT2165610	hsa-miR-559	CLIP-seq
MIRT760613	hsa-miR-576-3p	CLIP-seq
MIRT760614	hsa-miR-578	CLIP-seq
MIRT760616	hsa-miR-612	CLIP-seq
MIRT760617	hsa-miR-623	CLIP-seq
MIRT2165611	hsa-miR-626	CLIP-seq
MIRT1924268	hsa-miR-631	CLIP-seq
MIRT1924269	hsa-miR-654-5p	CLIP-seq
MIRT2165612	hsa-miR-661	CLIP-seq
MIRT2165613	hsa-miR-663	CLIP-seq
MIRT2165614	hsa-miR-668	CLIP-seq
MIRT2165615	hsa-miR-744	CLIP-seq
MIRT1924270	hsa-miR-770-5p	CLIP-seq
MIRT2165616	hsa-miR-873	CLIP-seq
MIRT2165617	hsa-miR-940	CLIP-seq
MIRT760599	hsa-miR-485-5p	CLIP-seq
MIRT2425895	hsa-miR-3654	CLIP-seq
MIRT2425896	hsa-miR-4698	CLIP-seq
MIRT2425897	hsa-miR-4740-3p	CLIP-seq
MIRT2425898	hsa-miR-711	CLIP-seq
MIRT2442962	hsa-miR-1343	CLIP-seq
MIRT2442963	hsa-miR-18a	CLIP-seq
MIRT2442964	hsa-miR-18b	CLIP-seq
MIRT760566	hsa-miR-3922-5p	CLIP-seq
MIRT2165568	hsa-miR-4270	CLIP-seq
MIRT2165575	hsa-miR-4441	CLIP-seq
MIRT2442965	hsa-miR-4640-5p	CLIP-seq
MIRT2165586	hsa-miR-4708-3p	CLIP-seq
MIRT2442966	hsa-miR-4726-5p	CLIP-seq
MIRT2442967	hsa-miR-4735-3p	CLIP-seq
MIRT2165587	hsa-miR-4753-5p	CLIP-seq
MIRT2165588	hsa-miR-4761-5p	CLIP-seq
MIRT2165554	hsa-miR-1266	CLIP-seq
MIRT2467709	hsa-miR-1270	CLIP-seq
MIRT2442963	hsa-miR-18a	CLIP-seq
MIRT2442964	hsa-miR-18b	CLIP-seq
MIRT2467710	hsa-miR-196a	CLIP-seq
MIRT2467711	hsa-miR-196b	CLIP-seq
MIRT2467712	hsa-miR-19a	CLIP-seq
MIRT2467713	hsa-miR-19b	CLIP-seq
MIRT2467714	hsa-miR-2115	CLIP-seq
MIRT2467715	hsa-miR-3155	CLIP-seq
MIRT2467716	hsa-miR-3155b	CLIP-seq
MIRT1924241	hsa-miR-3179	CLIP-seq
MIRT2467717	hsa-miR-3180	CLIP-seq
MIRT2467718	hsa-miR-3180-3p	CLIP-seq
MIRT2467719	hsa-miR-3184	CLIP-seq
MIRT2467720	hsa-miR-3185	CLIP-seq
MIRT2467721	hsa-miR-3190	CLIP-seq
MIRT2467722	hsa-miR-3196	CLIP-seq
MIRT2467723	hsa-miR-3616-3p	CLIP-seq
MIRT2467724	hsa-miR-378	CLIP-seq
MIRT2467725	hsa-miR-378b	CLIP-seq
MIRT2467726	hsa-miR-378c	CLIP-seq
MIRT2467727	hsa-miR-378d	CLIP-seq
MIRT2467728	hsa-miR-378e	CLIP-seq
MIRT2467729	hsa-miR-378f	CLIP-seq
MIRT2467730	hsa-miR-378h	CLIP-seq
MIRT2467731	hsa-miR-378i	CLIP-seq
MIRT760566	hsa-miR-3922-5p	CLIP-seq
MIRT2467732	hsa-miR-3927	CLIP-seq
MIRT1924248	hsa-miR-3936	CLIP-seq
MIRT2467733	hsa-miR-3937	CLIP-seq
MIRT2467734	hsa-miR-411	CLIP-seq
MIRT2467735	hsa-miR-422a	CLIP-seq
MIRT2467736	hsa-miR-4277	CLIP-seq
MIRT2467737	hsa-miR-4283	CLIP-seq
MIRT2467738	hsa-miR-432	CLIP-seq
MIRT2165573	hsa-miR-4434	CLIP-seq
MIRT760571	hsa-miR-4436b-3p	CLIP-seq
MIRT1924221	hsa-miR-4457	CLIP-seq
MIRT2467739	hsa-miR-4466	CLIP-seq
MIRT760575	hsa-miR-4476	CLIP-seq
MIRT2467740	hsa-miR-4487	CLIP-seq
MIRT2165578	hsa-miR-4516	CLIP-seq
MIRT2165579	hsa-miR-4518	CLIP-seq
MIRT2467741	hsa-miR-4531	CLIP-seq
MIRT1924256	hsa-miR-4651	CLIP-seq
MIRT760586	hsa-miR-4706	CLIP-seq
MIRT1924259	hsa-miR-4713-5p	CLIP-seq
MIRT760589	hsa-miR-4728-5p	CLIP-seq
MIRT1924222	hsa-miR-4731-3p	CLIP-seq
MIRT2467742	hsa-miR-4732-5p	CLIP-seq
MIRT2442967	hsa-miR-4735-3p	CLIP-seq
MIRT2467743	hsa-miR-4746-3p	CLIP-seq
MIRT760592	hsa-miR-4747-5p	CLIP-seq
MIRT760593	hsa-miR-4749-5p	CLIP-seq
MIRT2467744	hsa-miR-4786-3p	CLIP-seq
MIRT2467745	hsa-miR-4795-5p	CLIP-seq
MIRT1924223	hsa-miR-4801	CLIP-seq
MIRT760608	hsa-miR-520a-5p	CLIP-seq
MIRT760609	hsa-miR-525-5p	CLIP-seq
MIRT760612	hsa-miR-564	CLIP-seq
MIRT1924267	hsa-miR-608	CLIP-seq
MIRT2467746	hsa-miR-620	CLIP-seq
MIRT1924224	hsa-miR-642b	CLIP-seq
MIRT2467747	hsa-miR-675	CLIP-seq
MIRT2467748	hsa-miR-7	CLIP-seq
MIRT2165554	hsa-miR-1266	CLIP-seq
MIRT2467709	hsa-miR-1270	CLIP-seq
MIRT2442963	hsa-miR-18a	CLIP-seq
MIRT2442964	hsa-miR-18b	CLIP-seq
MIRT2467712	hsa-miR-19a	CLIP-seq
MIRT2467713	hsa-miR-19b	CLIP-seq
MIRT2467714	hsa-miR-2115	CLIP-seq
MIRT2467715	hsa-miR-3155	CLIP-seq
MIRT2467716	hsa-miR-3155b	CLIP-seq
MIRT1924241	hsa-miR-3179	CLIP-seq
MIRT2467717	hsa-miR-3180	CLIP-seq
MIRT2467718	hsa-miR-3180-3p	CLIP-seq
MIRT2467719	hsa-miR-3184	CLIP-seq
MIRT2467720	hsa-miR-3185	CLIP-seq
MIRT2467721	hsa-miR-3190	CLIP-seq
MIRT2467722	hsa-miR-3196	CLIP-seq
MIRT2674124	hsa-miR-3615	CLIP-seq
MIRT2467723	hsa-miR-3616-3p	CLIP-seq
MIRT2674125	hsa-miR-3646	CLIP-seq
MIRT2674126	hsa-miR-3662	CLIP-seq
MIRT2674127	hsa-miR-3917	CLIP-seq
MIRT760566	hsa-miR-3922-5p	CLIP-seq
MIRT1924248	hsa-miR-3936	CLIP-seq
MIRT2467733	hsa-miR-3937	CLIP-seq
MIRT2467736	hsa-miR-4277	CLIP-seq
MIRT2467737	hsa-miR-4283	CLIP-seq
MIRT2467738	hsa-miR-432	CLIP-seq
MIRT2165573	hsa-miR-4434	CLIP-seq
MIRT760571	hsa-miR-4436b-3p	CLIP-seq
MIRT1924221	hsa-miR-4457	CLIP-seq
MIRT2467739	hsa-miR-4466	CLIP-seq
MIRT760575	hsa-miR-4476	CLIP-seq
MIRT2165578	hsa-miR-4516	CLIP-seq
MIRT2165579	hsa-miR-4518	CLIP-seq
MIRT2467741	hsa-miR-4531	CLIP-seq
MIRT1924256	hsa-miR-4651	CLIP-seq
MIRT2674128	hsa-miR-4653-3p	CLIP-seq
MIRT760586	hsa-miR-4706	CLIP-seq
MIRT1924259	hsa-miR-4713-5p	CLIP-seq
MIRT760589	hsa-miR-4728-5p	CLIP-seq
MIRT1924222	hsa-miR-4731-3p	CLIP-seq
MIRT2442967	hsa-miR-4735-3p	CLIP-seq
MIRT2467743	hsa-miR-4746-3p	CLIP-seq
MIRT760592	hsa-miR-4747-5p	CLIP-seq
MIRT760593	hsa-miR-4749-5p	CLIP-seq
MIRT2467744	hsa-miR-4786-3p	CLIP-seq
MIRT2467745	hsa-miR-4795-5p	CLIP-seq
MIRT1924223	hsa-miR-4801	CLIP-seq
MIRT760608	hsa-miR-520a-5p	CLIP-seq
MIRT760609	hsa-miR-525-5p	CLIP-seq
MIRT760612	hsa-miR-564	CLIP-seq
MIRT1924267	hsa-miR-608	CLIP-seq
MIRT2467746	hsa-miR-620	CLIP-seq
MIRT1924224	hsa-miR-642b	CLIP-seq
MIRT2467747	hsa-miR-675	CLIP-seq
MIRT2467748	hsa-miR-7	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000278	Process	Mitotic cell cycle	TAS	24522549
GO:0000287	Function	Magnesium ion binding	IDA	9144171
GO:0000287	Function	Magnesium ion binding	IEA
GO:0000400	Function	Four-way junction DNA binding	IDA	9558345
GO:0000405	Function	Bubble DNA binding	IDA	9558345
GO:0001726	Component	Ruffle	IEA
GO:0001784	Function	Phosphotyrosine residue binding	IEA
GO:0001784	Function	Phosphotyrosine residue binding	IPI	20624904
GO:0001843	Process	Neural tube closure	IEA
GO:0001922	Process	B-1 B cell homeostasis	IEA
GO:0002252	Process	Immune effector process	IEA
GO:0002322	Process	B cell proliferation involved in immune response	IEA
GO:0002333	Process	Transitional one stage B cell differentiation	IEA
GO:0002429	Process	Immune response-activating cell surface receptor signaling pathway	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	NAS	8242749
GO:0003713	Function	Transcription coactivator activity	TAS	15865930
GO:0003785	Function	Actin monomer binding	IEA
GO:0003785	Function	Actin monomer binding	TAS	20841568
GO:0004515	Function	Nicotinate-nucleotide adenylyltransferase activity	TAS	20841568
GO:0004672	Function	Protein kinase activity	IDA	11120811
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	IMP	24863063
GO:0004674	Function	Protein serine/threonine kinase activity	IMP	24700464
GO:0004713	Function	Protein tyrosine kinase activity	EXP	15657136
GO:0004713	Function	Protein tyrosine kinase activity	IBA
GO:0004713	Function	Protein tyrosine kinase activity	IDA	7590236, 9144171, 10713049, 11121037, 12944467, 15657060, 17888034, 20823226
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IMP	22810897, 24520051
GO:0004713	Function	Protein tyrosine kinase activity	TAS	10391249
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IDA	9461559, 10518561
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IMP	28428613
GO:0005080	Function	Protein kinase C binding	IPI	10713049
GO:0005515	Function	Protein binding	IPI	9144171, 9168117, 9346925, 9461559, 9593709, 11374898, 11375976, 11418237, 11971963, 12384576, 15448168, 15657060, 15696159, 15886098, 16273093, 16397227, 16443220, 16831423, 16888623, 17101133, 17112510, 17318191, 17474147, 17515907, 17626041, 17888034, 18328268, 19234221, 19442657
GO:0005524	Function	ATP binding	IDA	9144171
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	9168116, 17626041, 17888034
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005634	Component	Nucleus	NAS	8242749
GO:0005634	Component	Nucleus	TAS	20841568
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA	12944467, 17626041
GO:0005737	Component	Cytoplasm	IDA	17515907
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	20841568
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	NAS	24522549
GO:0005829	Component	Cytosol	IDA	11120811
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0006281	Process	DNA repair	IEA
GO:0006298	Process	Mismatch repair	TAS	10391249
GO:0006355	Process	Regulation of DNA-templated transcription	TAS	8242749
GO:0006897	Process	Endocytosis	IEA
GO:0006909	Process	Phagocytosis	IEA
GO:0006909	Process	Phagocytosis	IEA
GO:0006914	Process	Autophagy	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006974	Process	DNA damage response	IDA	15657060
GO:0006974	Process	DNA damage response	IEA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0006979	Process	Response to oxidative stress	IGI	17626041
GO:0007155	Process	Cell adhesion	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IBA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IMP	24367707
GO:0007229	Process	Integrin-mediated signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	24863063
GO:0007249	Process	Canonical NF-kappaB signal transduction	IEA
GO:0007611	Process	Learning or memory	IEA
GO:0008047	Function	Enzyme activator activity	IDA	12893824
GO:0008306	Process	Associative learning	IEA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	TAS	10391249, 20841568
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009791	Process	Post-embryonic development	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010506	Process	Regulation of autophagy	IEA
GO:0010506	Process	Regulation of autophagy	TAS	20841568
GO:0010557	Process	Positive regulation of macromolecule biosynthetic process	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IBA
GO:0010595	Process	Positive regulation of endothelial cell migration	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	24863063
GO:0014069	Component	Postsynaptic density	IEA
GO:0015629	Component	Actin cytoskeleton	IEA
GO:0015629	Component	Actin cytoskeleton	TAS	20841568
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016301	Function	Kinase activity	IMP	28288113
GO:0016604	Component	Nuclear body	IDA
GO:0016740	Function	Transferase activity	IEA
GO:0019899	Function	Enzyme binding	IPI	12893824
GO:0019901	Function	Protein kinase binding	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0019905	Function	Syntaxin binding	IPI	23006999
GO:0021587	Process	Cerebellum morphogenesis	IEA
GO:0022408	Process	Negative regulation of cell-cell adhesion	IEA
GO:0030035	Process	Microspike assembly	IEA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	ISS
GO:0030041	Process	Actin filament polymerization	IEA
GO:0030100	Process	Regulation of endocytosis	IEA
GO:0030100	Process	Regulation of endocytosis	TAS	20841568
GO:0030145	Function	Manganese ion binding	IDA	9144171
GO:0030145	Function	Manganese ion binding	IEA
GO:0030155	Process	Regulation of cell adhesion	TAS	20841568
GO:0030182	Process	Neuron differentiation	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0030426	Component	Growth cone	IEA
GO:0030509	Process	BMP signaling pathway	IEA
GO:0030514	Process	Negative regulation of BMP signaling pathway	IEA
GO:0030516	Process	Regulation of axon extension	IMP	24520051
GO:0030845	Process	Phospholipase C-inhibiting G protein-coupled receptor signaling pathway	IMP	24367707
GO:0031113	Process	Regulation of microtubule polymerization	IMP	24520051
GO:0031252	Component	Cell leading edge	IEA
GO:0031965	Component	Nuclear membrane	IEA
GO:0032489	Process	Regulation of Cdc42 protein signal transduction	IMP	26051942
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032743	Process	Positive regulation of interleukin-2 production	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IMP	24520051, 24863063
GO:0032956	Process	Regulation of actin cytoskeleton organization	TAS	20841568
GO:0032991	Component	Protein-containing complex	IPI	12384576
GO:0033554	Process	Cellular response to stress	IEA
GO:0033690	Process	Positive regulation of osteoblast proliferation	IEA
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IEA
GO:0034599	Process	Cellular response to oxidative stress	IDA	12893824
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0034599	Process	Cellular response to oxidative stress	TAS	24522549
GO:0034976	Process	Response to endoplasmic reticulum stress	IEA
GO:0035556	Process	Intracellular signal transduction	IDA	9144171, 11121037
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035791	Process	Platelet-derived growth factor receptor-beta signaling pathway	IMP	24520051
GO:0036211	Process	Protein modification process	NAS	8242749
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0038189	Process	Neuropilin signaling pathway	IMP	24863063
GO:0038191	Function	Neuropilin binding	IEA
GO:0038191	Function	Neuropilin binding	IPI	24863063
GO:0042100	Process	B cell proliferation	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042169	Function	SH2 domain binding	IPI	12384576
GO:0042770	Process	Signal transduction in response to DNA damage	IDA	9037071, 15657060, 18280240
GO:0043025	Component	Neuronal cell body	IEA
GO:0043025	Component	Neuronal cell body	ISS
GO:0043065	Process	Positive regulation of apoptotic process	IDA	9037071
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0043539	Function	Protein serine/threonine kinase activator activity	IDA	10713049
GO:0043542	Process	Endothelial cell migration	IMP	24863063
GO:0045580	Process	Regulation of T cell differentiation	IEA
GO:0045580	Process	Regulation of T cell differentiation	ISS
GO:0045595	Process	Regulation of cell differentiation	IEA
GO:0045785	Process	Positive regulation of cell adhesion	IEA
GO:0045907	Process	Positive regulation of vasoconstriction	IEA
GO:0045930	Process	Negative regulation of mitotic cell cycle	IEA
GO:0045931	Process	Positive regulation of mitotic cell cycle	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	TAS	15865930
GO:0046632	Process	Alpha-beta T cell differentiation	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046875	Function	Ephrin receptor binding	IEA
GO:0046875	Function	Ephrin receptor binding	ISS
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IEA
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IEA
GO:0048013	Process	Ephrin receptor signaling pathway	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	17888034
GO:0048536	Process	Spleen development	IEA
GO:0048538	Process	Thymus development	IEA
GO:0050798	Process	Activated T cell proliferation	IEA
GO:0050852	Process	T cell receptor signaling pathway	IEA
GO:0050853	Process	B cell receptor signaling pathway	IEA
GO:0050885	Process	Neuromuscular process controlling balance	IEA
GO:0051015	Function	Actin filament binding	IEA
GO:0051019	Function	Mitogen-activated protein kinase binding	IPI	11121037
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051444	Process	Negative regulation of ubiquitin-protein transferase activity	IDA	20823226
GO:0051450	Process	Myoblast proliferation	IEA
GO:0051496	Process	Positive regulation of stress fiber assembly	IMP	24863063
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	TAS	24522549
GO:0051882	Process	Mitochondrial depolarization	TAS	24522549
GO:0051894	Process	Positive regulation of focal adhesion assembly	IMP	24863063
GO:0060020	Process	Bergmann glial cell differentiation	IEA
GO:0060038	Process	Cardiac muscle cell proliferation	IEA
GO:0060563	Process	Neuroepithelial cell differentiation	IEA
GO:0070064	Function	Proline-rich region binding	IDA	15657060
GO:0070097	Function	Delta-catenin binding	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	IDA	10713049
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0071103	Process	DNA conformation change	IDA	9558345
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0071871	Process	Response to epinephrine	IEA
GO:0072359	Process	Circulatory system development	IEA
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IEA
GO:0090398	Process	Cellular senescence	IEA
GO:0097100	Function	Supercoiled DNA binding	IDA	9558345
GO:0097706	Process	Vascular endothelial cell response to oscillatory fluid shear stress	TAS
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098794	Component	Postsynapse	TAS	24658113
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099150	Process	Regulation of postsynaptic specialization assembly	IEA
GO:0141214	Process	Positive regulation of phospholipase C/protein kinase C signal transduction	IDA	10713049
GO:1900006	Process	Positive regulation of dendrite development	IEA
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IMP	24863063
GO:1900272	Process	Negative regulation of long-term synaptic potentiation	IEA
GO:1900272	Process	Negative regulation of long-term synaptic potentiation	ISS
GO:1901701	Process	Cellular response to oxygen-containing compound	IEA
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS
GO:1902531	Process	Regulation of intracellular signal transduction	IEA
GO:1903053	Process	Regulation of extracellular matrix organization	IEA
GO:1903055	Process	Positive regulation of extracellular matrix organization	IEA
GO:1903210	Process	Podocyte apoptotic process	IEA
GO:1903351	Process	Cellular response to dopamine	TAS	24522549
GO:1903905	Process	Positive regulation of establishment of T cell polarity	IEA
GO:1903905	Process	Positive regulation of establishment of T cell polarity	ISS
GO:1904157	Process	DN4 thymocyte differentiation	IEA
GO:1904518	Process	Protein localization to cytoplasmic microtubule plus-end	IMP	24520051
GO:1905244	Process	Regulation of modification of synaptic structure	IEA
GO:1905244	Process	Regulation of modification of synaptic structure	ISS
GO:1905555	Process	Positive regulation of blood vessel branching	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	9558345
GO:2000042	Process	Negative regulation of double-strand break repair via homologous recombination	IDA	9461559
GO:2000096	Process	Positive regulation of Wnt signaling pathway, planar cell polarity pathway	IEA
GO:2000145	Process	Regulation of cell motility	TAS	20841568
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IEA
GO:2000406	Process	Positive regulation of T cell migration	IEA
GO:2000406	Process	Positive regulation of T cell migration	ISS
GO:2000772	Process	Regulation of cellular senescence	IEA
GO:2000773	Process	Negative regulation of cellular senescence	IEA

Other IDs

• MIM: 189980
• HGNC: 76
• e!Ensembl: ENSG00000097007

Protein

• UniProt ID: P00519
• Protein name: Tyrosine-protein kinase ABL1 (EC 2.7.10.2) (Abelson murine leukemia viral oncogene homolog 1) (Abelson tyrosine-protein kinase 1) (Proto-oncogene c-Abl) (p150)
• Protein function: Non-receptor tyrosine-protein kinase that plays a role in many key processes linked to cell growth and survival such as cytoskeleton remodeling in response to extracellular stimuli, cell motility and adhesion, receptor endocytosis, autophagy, DN
• PDB: 1AB2, 1AWO, 1BBZ, 1JU5, 1OPL, 1ZZP, 2ABL, 2E2B, 2F4J, 2FO0, 2G1T, 2G2F, 2G2H, 2G2I, 2GQG, 2HIW, 2HYY, 2HZ0, 2HZ4, 2HZI, 2O88, 2V7A, 3CS9, 3EG0, 3EG1, 3EG2, 3EG3, 3EGU, 3K2M, 3PYY, 3QRI, 3QRJ, 3QRK, 3T04, 3UE4, 3UYO, 4J9B, 4J9C, 4J9D, 4J9E, 4J9F, 4J9G, 4J9H, 4J9I, 4JJB, 4JJC, 4JJD, 4TWP, 4WA9, 4XEY, 4YC8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00018	SH3_1	67 → 113	SH3 domain	Domain
  PF00017	SH2	127 → 202	SH2 domain	Domain
  PF07714	PK_Tyr_Ser-Thr	242 → 493	Protein tyrosine and serine/threonine kinase	Domain
  PF08919	F_actin_bind	1025 → 1130	F-actin binding	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed.
• Sequence:

  MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSE
  NDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
  SLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTAS
  DGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERT
  DITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQ
  LLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFI
  HRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKS
  DVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNP
  SDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAE
  HRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLF
  SALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSP
  KPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATGEEEGGGSSSKRFLRSCSAS
  CVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTV
  TPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGS
  ALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPP
  PPPAASAGKAGGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVL
  PATPKPQSAKPSGTPISPAPVPSTLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPE
  RIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNK
  FAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSVKEISDIVQR

• Sequence length: 1130

Pathways

KEGG:

ErbB signaling pathway
Ras signaling pathway
Cell cycle
Axon guidance
Neurotrophin signaling pathway
Pathogenic Escherichia coli infection
Pathways in cancer
MicroRNAs in cancer
Chemical carcinogenesis - reactive oxygen species
Chronic myeloid leukemia
Viral myocarditis

Reactome:

Regulation of actin dynamics for phagocytic cup formation
Role of ABL in ROBO-SLIT signaling
Myogenesis
RHO GTPases Activate WASPs and WAVEs
HDR through Single Strand Annealing (SSA)
Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks
Cyclin D associated events in G1
RUNX1 regulates transcription of genes involved in differentiation of HSCs
FCGR3A-mediated phagocytosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
ABL1-related disorder	Likely pathogenic; Pathogenic	rs1831099962	RCV001249439	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Abnormal skeletal morphology	Pathogenic; Likely pathogenic	rs1060499548, rs1060499547	RCV000445566 RCV000445576	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Chronic myelogenous leukemia, BCR-ABL1 positive	Likely pathogenic; Pathogenic	rs121913459, rs137853304, rs121913457	RCV000432136 RCV000013463 RCV000420800	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Congenital heart defects and skeletal malformations syndrome	Likely pathogenic; Pathogenic	rs1355021408, rs2133017541, rs2132956266, rs2133022634, rs2490715483, rs2490721921, rs1060499548, rs1060499547, rs1831097846, rs1831432715, rs1831388695, rs1831432776, rs1831433011, rs1830947813	RCV001330378 RCV001543418 RCV002273061 RCV002466765 RCV003148148 RCV003986042 RCV000496371 RCV000496944 RCV001175161 RCV001265618 RCV001263086 RCV001263087 RCV001263088 RCV001269278	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Congenital heart disease	Pathogenic; Likely pathogenic	rs1060499548, rs1060499547	RCV000445566 RCV000445576	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Failure to thrive	Pathogenic; Likely pathogenic	rs1060499548, rs1060499547	RCV000445566 RCV000445576	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Leukemia, Philadelphia chromosome-positive, resistant to imatinib	Likely pathogenic; Pathogenic	rs121913459, rs387906516, rs387906517, rs121913461	RCV000013459 RCV000013460 RCV000013461 RCV000013462	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Lip and oral cavity carcinoma	Pathogenic	rs121913449, rs121913454	RCV001255639 RCV001255640	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Microcephaly	Likely pathogenic; Pathogenic	rs1831432776	RCV001527376	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Moyamoya angiopathy	Likely pathogenic	rs1830947762	RCV004704502	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ABL1-related congenital heart defects and skeletal malformations syndrome	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-LYMPHOBLASTIC LEUKEMIA/LYMPHOMA WITH T	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blast phase chronic myelogenous leukemia, BCR-ABL1 positive	-	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE DEVELOPMENT DISEASE	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE DISEASES, DEVELOPMENTAL	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOGENESIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC MYELOID LEUKEMIA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL CONTRACTURAL ARACHNODACTYLY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DEFECTS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL MUSCULOSKELETAL ANOMALIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONNECTIVE TISSUE DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONNECTIVE TISSUE DISORDER	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL DISABILITIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental disorder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DEFECTS, CONGENITAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, CHRONIC MYELOID	—	HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental abnormality	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TETRALOGY OF FALLOT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
2-3 toe syndactyly	Syndactyly Of The Toes	CLINVAR_DG	28288113		★☆☆☆☆ Found in Text Mining only
Abetalipoproteinemia	Abetalipoproteinemia	BEFREE	11896544, 12764379, 14697634, 15282669, 16487173, 16670264, 17392503, 19480935, 26321052, 28386107, 29030834, 30626204, 7590733, 7596189, 9087564		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	16916543, 1997745, 31428968, 7967712		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	10674911, 10812164, 11069038, 11222387, 11734316, 12631253, 12707370, 12755554, 12764379, 1317490, 17852464, 18193087, 18528425, 19234145, 1985690, 20137810, 2013978, 20589932, 20863155, 2223647, 24123676, 24998463, 2678002, 2685476, 27229714, 27665024, 28445932, 28581459, 8109597, 8562932, 9365838		★☆☆☆☆ Found in Text Mining only
Acute lymphoblastic leukemia with lymphomatous features	Lymphoblastic Leukemia With Lymphomatous Features	CLINVAR_DG	11853795, 11861307, 18615627, 22772060, 25157968		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10037003, 10088201, 10198617, 10374861, 10456671, 10459357, 10468851, 10500826, 10615128, 10637472, 10640143, 10654022, 10913673, 11049022, 11054070, 11071360, 11264164, 11287973, 11369654, 11801312, 11861265, 11861307, 12040449, 12185586, 12399961, 12419587, 12447959, 12707370, 12750174, 12759927, 12764379, 12960692, 1353550, 1493473, 14993251, 1515646, 1516023, 15265366, 15315963, 15611260, 15681473, 1568446, 15716990, 15721638, 15781610, 15789066, 15820957, 15908956, 16157197, 16205638, 16213359, 16219545, 16243790, 16300960, 16523310, 16572268, 16618932, 16932347, 16938575, 16979235, 17312329, 17485517, 17498558, 17683977, 17701954, 17909799, 18024662, 18193087, 18202228, 18253707, 18408710, 18519632, 18603297, 18656692, 18722880, 18831787, 19027489, 19095773, 19129520, 19138562, 19158828, 19194200, 19215796, 19322212, 19322628, 19438471, 19587702, 19589926, 19608682, 19654305, 19759560, 19770381, 19816207, 19817644, 20013897, 20471447, 20534699, 20564080, 20589932, 20633771, 2070081, 20701601, 20703256, 20930648, 21082971, 21112035, 21178708, 21242186, 21248843, 21263154, 21332651, 21391972, 21414819, 21536647, 21623761, 21694468, 21822204, 21863287, 21933042, 21944569, 21960589, 22005133, 22021366, 22134481, 22238115, 22587422, 22591684, 22693568, 22705992, 22749885, 22985168, 22994759, 22997141, 23065506, 23212523, 23319569, 2334939, 23679247, 23804397, 23881917, 23911702, 24095735, 24112092, 24215620, 24280866, 24319172, 24366361, 24444868, 24468836, 24630366, 24710003, 24848770, 24961450, 2498881, 24997151, 25261097, 25312094, 25520136, 2567002, 25686603, 25799995, 25895602, 25919613, 25997106, 26050650, 26221900, 26321221, 26449660, 2649173, 26773444, 26892479, 26925663, 27095570, 27198500, 27229714, 27447561, 2747638, 27588474, 27786412, 27821800, 27865806, 27870151, 28103625, 28329763, 28372728, 28444777, 28451802, 28579617, 28581459, 28709134, 29047122, 29177615, 29219890, 29256044, 29318644, 29423065, 29434963, 29675955, 29726059, 29859988, 30028819, 30121665, 30125757, 30300827, 30401948, 30546081, 30591491, 30675008, 30790375, 30858550, 30916583, 31173268, 3118359, 31295447, 31296070, 31563145, 31566728, 31594548, 3283653, 3289649, 3422516, 3543692, 7521685, 7564511, 7769362, 7777499, 7786792, 7786793, 8109597, 8142658, 8242587, 8289486, 8289491, 8398840, 8428799, 8464245, 8483319, 8490164, 8542955, 8608244, 8625254, 8632666, 8632906, 8639433, 8639438, 8649053, 8652835, 8667652, 8756076, 9009095, 9054670, 9160683, 9250788, 9369422, 9372085, 9585083, 9593263, 9648560, 9665191, 9760154, 9787174, 9790503, 9858221, 9973946		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	22075327		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	10905055, 28971504, 9266939		★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	10905055, 23054652		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	11750052, 18769896, 22845480, 28654205		★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	17569777, 31817512		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	21472143		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	21472143		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23922113, 30956771, 31666936		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	21472143		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	21472143		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	21472143		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10198617, 10456671, 10637472, 10913673, 11049022, 11071360, 11264164, 11801312, 11861265, 12040449, 12419587, 12707370, 12750174, 12759927, 12764379, 1467514, 14993251, 1515646, 1516023, 15265366, 15282669, 15315963, 15611260, 15681473, 1568446, 15908956, 15930891, 1593911, 16157197, 16213359, 16523310, 16932347, 16938575, 16979235, 17312329, 17485517, 17498558, 17701954, 17909799, 18055996, 18193087, 18656692, 18728022, 18831787, 19100369, 19129520, 19194200, 19215796, 19322628, 19589926, 19759560, 19770381, 19817644, 19924795, 20013897, 20471447, 20564080, 20589932, 20703256, 20930648, 21082971, 21178708, 21263154, 21332651, 21414819, 21933042, 21944569, 21960589, 22134481, 22238115, 22360868, 22591684, 22693568, 22705992, 22749885, 22994759, 22997141, 23212523, 23319569, 23881917, 24112092, 24215620, 24630366, 24710003, 2498881, 25520136, 2567002, 25675863, 25997106, 26221900, 26321221, 26449660, 2649173, 26854094, 26892479, 26925663, 27095570, 27588474, 27786412, 27865806, 27870151, 28444777, 28451802, 28579617, 29318644, 29423065, 29434963, 29859988, 30121665, 30125757, 30300827, 30591491, 30858550, 30916583, 31296070, 31594548, 7564511, 7934164, 8142658, 8321020, 8428799, 8464245, 8483319, 8490164, 8608244, 8625254, 8632666, 8652835, 8667652, 8756076, 9009095, 9160683, 9250788, 9369422, 9585083, 9665191, 9737699, 9760154, 9790503, 9973946		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	3025859		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19363261, 25219501, 31755389, 36552734	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	16240349, 17824900		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	28539470, 32005289, 36552734	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	11222387, 18815194		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	21804629, 32954738	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	35731275	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic Autoimmune	Autoimmune hemolytic anemia	Pubtator	32118733	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	34625105	Associate	★☆☆☆☆ Found in Text Mining only
Angiofibroma	Angiofibroma	BEFREE	28639284		★☆☆☆☆ Found in Text Mining only
Anus, Imperforate	Imperforate anus	CLINVAR_DG	28288113		★☆☆☆☆ Found in Text Mining only
Arachnodactyly	Arachnodactyly	GENOMICS_ENGLAND_DG	28288113		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	15367334	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	17609427	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	CLINVAR_DG	28288113		★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28380378		★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	11054070, 11097354, 11287973, 11368359, 11746976, 11801308, 11964322, 12406084, 12663457, 12960692, 15621812, 15744351, 15747376, 15996933, 16775234, 17130834, 17167971, 17405907, 17683977, 18401881, 18615627, 18704194, 18986386, 19095773, 20001232, 20002159, 20388735, 20425368, 20720184, 21193419, 21263154, 21370430, 21960589, 22323189, 22587422, 22593461, 22772060, 22895079, 22985168, 23190221, 23521501, 23575252, 23989453, 24112092, 24130846, 24260131, 24350829, 24357015, 24382642, 24630366, 24652384, 2498881, 25127392, 25300870, 25331939, 25415187, 25499760, 25842192, 25887498, 25894969, 25895602, 25979368, 26980048, 27537935, 27582059, 27927646, 28103625, 2820585, 2833755, 28654205, 28779753, 28971501, 29046392, 29079599, 29233926, 29256412, 29284366, 29388066, 29567798, 29572111, 29575541, 29578162, 30093398, 30154155, 30251548, 3027581, 30334451, 30389549, 30831480, 30858550, 31006307, 31136068, 31149920, 31349760, 3179449, 7869772, 8109597, 8289476, 8324740, 8490164, 8562932, 8656674, 9050373		★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	2094324, 24060591, 28958480		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	12802927		★☆☆☆☆ Found in Text Mining only
Bjornstad syndrome	Bjornstad syndrome	Pubtator	34979982	Stimulate	★☆☆☆☆ Found in Text Mining only
Blast Crisis	Blast crisis	Pubtator	12823349, 15050919, 16304379, 18202228, 19048492, 19563513, 20010464, 20015884, 22653972, 29022901, 29967129, 30583336, 32052899, 32366154, 35456386, 35815090, 38188610	Associate	★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	10049047, 10190307, 10526530, 10985361, 11233781, 11264175, 11287973, 11516106, 11746976, 11753385, 12032333, 12145676, 12204532, 12399961, 12476309, 12547154, 12620409, 12631253, 12649177, 12743326, 12759927, 12781448, 12823349, 12890867, 12921956, 1515646, 15223635, 15381060, 15448745, 15674331, 15723338, 15747376, 15867198, 16007188, 16298826, 16304379, 16442619, 17284533, 17610380, 1794439, 18068536, 18156496, 18193087, 18338755, 18343792, 18566326, 18766960, 18827185, 19074122, 19234145, 19237556, 1932296, 19348122, 19432895, 19506164, 19723894, 19732723, 20015884, 20082691, 2013978, 20228846, 20445577, 20520635, 20842730, 21156844, 21264552, 21275954, 21299458, 21357704, 21501493, 21504717, 21523337, 21527515, 21872826, 22234689, 2223646, 2223647, 22431575, 22653972, 23275297, 23284724, 23575252, 23737503, 24098673, 2434223, 24500518, 25127392, 25501026, 25520136, 25547679, 25887498, 25916436, 26179066, 26304963, 26423566, 2683759, 26864341, 27198500, 27217448, 27908728, 28232743, 28444777, 28523104, 2885048, 29022901, 29683667, 30055547, 30511400, 30587215, 31276961, 31615652, 3164635, 7683349, 8152300, 8398844, 8652835, 9858221		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	LHGDN	12921956, 17889935		★☆☆☆☆ Found in Text Mining only
Bone Diseases, Developmental	Bone Disease	CTD_human_DG	28288113		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bone Diseases, Developmental	Bone Disease	BEFREE	29226717		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	10071278, 15483033, 18221038, 20234815, 21480391, 22845480, 23299156, 24960160, 25803821, 26615134, 26838548, 29522716, 29774130		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	20234815		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18042273, 20234815, 22238610, 22608253, 22865780, 23892407, 24789045, 28661474, 30488343, 32734521	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	23383209	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Burkitt Leukemia	Burkitt`s Lymphoma	BEFREE	21391972, 2406517		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	ORPHANET_DG	23491079		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	28515100, 8408711		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	37503586, 8408711	Associate	★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29022901	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19897486, 30775435, 37224078	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26615134, 26758680		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37533202	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	29056573, 30297534	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	38068992	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36869079	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	21472143		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	21472143		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23273547		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	24797802		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	28451802	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	18645191, 20520635, 22382182, 23383600		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	27899378		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	15382063, 27899378		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10198617, 10456671, 10637472, 10913673, 11049022, 11071360, 11264164, 11801312, 12040449, 12419587, 12707370, 12750174, 12759927, 12764379, 14525776, 14603332, 1467514, 14993251, 1515646, 1516023, 15265366, 15315963, 15611260, 15681473, 1568446, 15716990, 15908956, 16157197, 16213359, 16523310, 16791263, 16932347, 16938575, 16979235, 17312329, 17485517, 17498558, 17701954, 17909799, 18193087, 18656692, 18665825, 18831787, 19129520, 19194200, 19215796, 19322628, 19470474, 19589926, 19759560, 19817644, 20013897, 20471447, 20564080, 20589932, 20703256, 20930648, 21082971, 21178708, 21263154, 21332651, 21414819, 21933042, 21944569, 21960589, 22134481, 22238115, 22591684, 22693568, 22705992, 22749885, 22994759, 22997141, 23212523, 23317202, 23319569, 23881917, 24112092, 24215620, 24630366, 24710003, 24976218, 2498881, 25244981, 25520136, 2567002, 25696852, 25997106, 26221900, 26266519, 26321221, 26449660, 2649173, 26892479, 26925663, 27095570, 27588474, 27786412, 27865806, 27870151, 28444777, 28451802, 28579617, 28748759, 29219890, 29318644, 29423065, 29434963, 29726059, 29859988, 30121665, 30125757, 30300827, 30591491, 30858550, 30916583, 31296070, 31594548, 7564511, 8142658, 8428799, 8464245, 8483319, 8490164, 8608244, 8625254, 8632666, 8652835, 8667652, 8751462, 8756076, 9009095, 9160683, 9250788, 9369422, 9523202, 9585083, 9665191, 9760154, 9790503, 9973946		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG	11984797, 21898527		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	26221900		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	10748867	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	21318952	Associate	★☆☆☆☆ Found in Text Mining only
Chronic eosinophilic leukemia	Eosinophilic Leukemia	BEFREE	17215855, 17555450		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28298076, 31257514		★☆☆☆☆ Found in Text Mining only
Chronic leukemia (category)	Leukemia	BEFREE	9676840		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12802927, 12855552, 15262435, 16885384, 16983347, 18796631		★☆☆☆☆ Found in Text Mining only
Chronic myeloid leukemia	Myeloid Leukemia	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	10374861, 10500825, 11069038, 11904740, 12542482, 12667992, 12855552, 12890867, 12960692, 14976047, 15505216, 15723338, 15796968, 16321848, 16610578, 16777224, 16931578, 16960151, 17230231, 17305499, 17498558, 17545631, 17554060, 17996650, 18024651, 18464114, 18528425, 18754027, 18757400, 18767145, 18769448, 18923436, 18971950, 19147089, 19167611, 19175693, 19262601, 19394693, 19466975, 19580432, 19605820, 19806146, 19846812, 19858050, 19939582, 20002154, 20417861, 20425385, 20428194, 20472827, 20553273, 20809224, 21245760, 21299455, 21527514, 21555228, 21646683, 21723416, 21742423, 21823028, 21892537, 22035746, 22051730, 22106054, 22170483, 22234689, 22304488, 22328017, 22333011, 22460584, 22793267, 22847163, 22864358, 23010802, 23186533, 23211037, 23233154, 23264112, 23349688, 23420150, 23558526, 23781511, 23986553, 24309205, 24927924, 25227185, 25232060, 25349114, 25932444, 25959311, 25997600, 26062813, 26071474, 26181658, 26284455, 26331539, 26361084, 26370832, 26440973, 26487696, 26492355, 26563376, 26852656, 26933174, 27039813, 27090962, 27161873, 27258562, 27447873, 27624943, 27672139, 27686171, 27756071, 27939919, 28297629, 28298076, 28335073, 28340692, 28370510, 28406068, 28415571, 28497580, 28499938, 28543980, 28554272, 28559287, 28914569, 28990497, 29134817, 29256926, 29466766, 29560522, 29562644, 29611379, 29845291, 29951914, 29975001, 30030958, 30074634, 30084272, 30084669, 30155552, 30353413, 30463063, 30553471, 30581159, 30594750, 30769020, 30772299, 31206255, 31208359, 31413564, 31450973, 31837444, 7668224, 8152300, 8321046, 8527391, 8908174		★☆☆☆☆ Found in Text Mining only
Chronic Neutrophilic Leukemia	Neutrophilic Leukemia	BEFREE	12472276, 23656643, 24081659, 25575036, 30458320, 30581159, 9747637		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	30714299, 31350815	Associate	★☆☆☆☆ Found in Text Mining only
Clinodactyly	Clinodactyly	GENOMICS_ENGLAND_DG	28288113		★☆☆☆☆ Found in Text Mining only
Clinodactyly of fingers	Clinodactyly	GENOMICS_ENGLAND_DG	28288113		★☆☆☆☆ Found in Text Mining only
Clinodactyly of fingers	Clinodactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Clinodactyly of the 5th finger	Camptodactyly of fingers	CLINVAR_DG	28288113		★☆☆☆☆ Found in Text Mining only
Cobblestone Lissencephaly	Cobblestone lissencephaly	Pubtator	26016997	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	3477801		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17196995, 22845480		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12681507, 17196995, 20233444, 31782259	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17196995		★☆☆☆☆ Found in Text Mining only
Complement Component C1s Deficiency	Complement component deficiency	Pubtator	31537905	Associate	★☆☆☆☆ Found in Text Mining only
Congenital abnormality of vein	Venous malformation	BEFREE	30626204		★☆☆☆☆ Found in Text Mining only
Congenital Camptodactyly	Congenital Camptodactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	10602411, 10812164, 12015767, 12399961, 12447959, 12547154, 12646934, 14752867, 14987402, 15282669, 16080957, 17391756, 18474303, 18728022, 19215794, 19480935, 20015884, 20445577, 21242186, 22057509, 22372202, 22382182, 22411871, 22616753, 23483480, 23543457, 23679247, 2511093, 27281463, 27581135, 27810077, 27924671, 28550639, 9109934, 9196135, 9365838		★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	CLINVAR_DG	28288113		★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	28288113		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Heart Defects	Congenital heart defects	CTD_human_DG	28288113		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DEFECTS AND SKELETAL MALFORMATIONS SYNDROME	Congenital Heart Defects And Skeletal Malformations Syndrome	GENOMICS_ENGLAND_DG	28288113		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
CONGENITAL HEART DEFECTS AND SKELETAL MALFORMATIONS SYNDROME	Congenital Heart Defects And Skeletal Malformations Syndrome	UNIPROT_DG	28288113		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
CONGENITAL HEART DEFECTS AND SKELETAL MALFORMATIONS SYNDROME	Congenital Heart Defects And Skeletal Malformations Syndrome	CLINVAR_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Congenital heart disease	Congenital Heart Disease	BEFREE	28288113		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Congenital heart disease	Congenital Heart Disease	CLINVAR_DG	28288113		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Congenital musculoskeletal anomalies	Congenital Musculoskeletal Anomalies	CTD_human_DG	28288113		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital pectus excavatum	Congenital Pectus Excavatum	CLINVAR_DG	28288113		★☆☆☆☆ Found in Text Mining only
Congenital pectus excavatum	Congenital Pectus Excavatum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28098949		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	23364394		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	CLINVAR_DG	28288113		★☆☆☆☆ Found in Text Mining only
Cutis marmorata	Cutis marmorata	CLINVAR_DG	28288113		★☆☆☆☆ Found in Text Mining only
Cutis marmorata	Cutis marmorata	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cytochrome c Oxidase Deficiency	Cytochrome c oxidase deficiency	Pubtator	22174159	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	27666407, 31396300		★☆☆☆☆ Found in Text Mining only
Desmoid disease hereditary	Desmoid tumor	Pubtator	37943631	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	33890634	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28380378		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	28380378		★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	36766762	Associate	★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	24863063		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	15193435, 18202228, 20442364, 22484421		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	18202228, 25049327	Associate	★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	30827726	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Stromal Sarcoma	Endometrial Stromal Sarcoma	BEFREE	23018215		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	35587747	Associate	★☆☆☆☆ Found in Text Mining only
Enteropathy-Associated T-Cell Lymphoma	Enteropathy-Associated T-Cell Lymphoma	BEFREE	15756589		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	LHGDN	12505259		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	19175693, 24813417, 30948162		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	20955401, 37454239	Associate	★☆☆☆☆ Found in Text Mining only
Epileptic Encephalopathy Early Infantile 3	Developmental and epileptic encephalopathy	Pubtator	33223528	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	23117882		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	21472143		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	23117882		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	23117882	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Exanthema	Exanthema	Pubtator	28224300	Associate	★☆☆☆☆ Found in Text Mining only
Familial thrombocytosis	Thrombocytosis	BEFREE	19843380		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	21203397	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	21519342, 28544907		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	21519342, 28544907		★☆☆☆☆ Found in Text Mining only
Frontal bossing	Frontal bossing	CLINVAR_DG	28288113		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	16240349, 17824900		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	37108401	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	21454413		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	30704478	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	11751374, 15236194, 15342366, 16786129, 19176456, 21599631, 27965460		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	27965460	Associate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	11877286	Associate	★☆☆☆☆ Found in Text Mining only
Generalized enlarged lymph nodes	Enlarged Lymph Nodes	BEFREE	16777224		★☆☆☆☆ Found in Text Mining only
Genetic Predisposition to Disease	Genetic predisposition to disease	Pubtator	32378810	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19275932, 23383209, 27293031, 27732969, 34875133	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	2334939, 27732969		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	12592364, 2334939, 27732969		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	12829610	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	30619371		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	10931454		★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	24698424		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	34635145	Associate	★☆☆☆☆ Found in Text Mining only
Headache	Headache	Pubtator	28224300	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	33223528	Associate	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	33223528	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28098949		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	18223278	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	12842979, 12893773, 15389905, 16291747, 18079735, 19010823, 19135771, 20417861, 2224129, 22349810, 23637631, 24813251, 25887498, 3456250, 37895201	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	15193435, 16610578, 16683885, 18566539, 18656692, 18722880, 19432895, 20417861, 20589932, 21435002, 22762548, 23171811, 23965958, 24813251, 26149409, 27229714, 27694901, 28650474, 28804122, 29388066, 30574454, 31425923, 8251903, 9209443		★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	10721788, 16341034, 21500096, 21712707, 28409295, 31706847, 8289486, 8640172		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	12759926, 15389905, 15626746, 18391983, 18538733, 20841568, 23171811, 25775523, 29859988, 30019447		★☆☆☆☆ Found in Text Mining only
HEMOPHAGOCYTIC LYMPHOHISTIOCYTOSIS, FAMILIAL, 2	Hemophagocytic Lymphohistiocytosis	BEFREE	7600533, 8649822		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	20018760, 23107779, 30775435, 32859541, 33890726	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	23341351		★☆☆☆☆ Found in Text Mining only
Hereditary Leiomyomatosis and Renal Cell Cancer	Hereditary Leiomyomatosis and Renal Cancer	BEFREE	30297534		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	15860359		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	21385932	Associate	★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	16906325	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	10688838	Associate	★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypotension	Hypotension	Pubtator	22691121, 36485103	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21071498, 27055152	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21347297	Inhibit	★☆☆☆☆ Found in Text Mining only
Idiopathic Hypereosinophilic Syndrome	Hypereosinophilic Syndrome	BEFREE	15921374, 19176456, 25431951		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28283735		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	10477735, 15674417, 25133686, 27581149, 8917557		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	20882436, 22195406, 22511494, 24164563, 8527391		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	16618932		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	25490448		★☆☆☆☆ Found in Text Mining only
L2 Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG	11984797, 21898527		★☆☆☆☆ Found in Text Mining only
Large cell carcinoma of lung	Lung Carcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	15894930		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10210325, 10477734, 10536003, 10682862, 10688835, 10727459, 10979973, 11157490, 11313280, 11877286, 11964283, 12086872, 12594572, 12642693, 12730115, 12881321, 12893773, 1348433, 14517214, 14573782, 14645012, 14993251, 15039284, 15042680, 15094045, 1515646, 15202948, 15251979, 15388581, 15502840, 15514006, 15558795, 15607956, 15747376, 15939795, 16393970, 16638124, 1665348, 16741250, 16906325, 16970408, 17008552, 1705008, 17218385, 17294703, 17325341, 17339191, 17389688, 17638851, 17922071, 18079735, 18202228, 18339898, 18367481, 18367669, 18809762, 19129918, 19576252, 19710400, 19880777, 20145167, 20571063, 20575039, 20616057, 20697350, 21368869, 21447799, 21680795, 21887305, 21892628, 21926354, 21991326, 22151181, 2224129, 22898604, 23180012, 23211037, 23233201, 23269287, 23746052, 23965958, 24155950, 24244612, 24339928, 24349524, 24813251, 24836440, 25029499, 25132497, 25450971, 25802333, 25919613, 26017033, 2601719, 26147002, 2614751, 26317515, 26321002, 26375673, 26627251, 26644081, 2683759, 26985855, 27166638, 27167108, 27229714, 2747638, 27566554, 28036294, 28111465, 28202504, 28366933, 28522576, 28596283, 28599273, 28650474, 28836580, 28902850, 29733872, 29967475, 29976745, 30049824, 30281597, 30704478, 3103721, 31252559, 31318870, 31349760, 31594548, 3160729, 31638195, 3165197, 31761618, 31817063, 31977890, 3299055, 33356083, 33369447, 33429764, 33952249, 34638557, 3465378, 34830455, 35239999, 35906470, 35963522, 35999358, 36172171, 36535407, 36595475, 3670297, 36959211, 37445655, 37510256, 37554265, 37995643, 38171244, 6091099, 7579358, 7662984, 8119916, 8204887, 8259165, 8329715, 8490164, 8609065, 8642285, 8652835, 8754809, 8896419, 9002963, 9593785, 9616138, 9988744	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10224280, 10233416, 10615128, 10766197, 11114130, 11170285, 11222387, 11358380, 11358387, 11368359, 11380477, 11431711, 11561160, 11587362, 11607816, 11753602, 11801312, 11853795, 11901483, 11964320, 12082638, 12161353, 12185586, 12573349, 12631253, 12714574, 12781706, 12890867, 1302582, 1515646, 15193448, 15194504, 15254401, 15650267, 15735690, 15739279, 15747376, 15833859, 16080957, 16146726, 16205638, 16651519, 1673492, 16757427, 16775234, 17008552, 17068153, 1712671, 17189410, 17344919, 17353369, 17485517, 17545610, 1756491, 17671436, 17980712, 18172853, 18181176, 18253707, 18268096, 18385754, 18401417, 1847983, 18528425, 18577747, 1857987, 18602021, 18603297, 18663364, 1868241, 18684865, 18704194, 18809762, 18936234, 19007191, 19013641, 19171873, 19270722, 19358301, 19421140, 19554484, 19557636, 19654305, 1985690, 19874801, 19959093, 19965668, 20012403, 2005881, 20124512, 20300999, 20445577, 20471447, 2056770, 20659155, 20724541, 20838376, 20844563, 21118985, 21178708, 21203982, 21220747, 21239056, 21297225, 21299458, 21391972, 21455220, 21653319, 21693657, 21933042, 21944569, 22025499, 22125070, 22204395, 22232214, 22300134, 22665066, 22772060, 22895079, 22912393, 23180012, 23204129, 23233201, 23319824, 23324740, 23382113, 23575066, 23666687, 23666688, 23881917, 23906051, 23970380, 2406517, 24095735, 24100660, 24123676, 24215620, 24349524, 24365090, 24480987, 24490604, 24586514, 24705490, 24791856, 24813920, 25025064, 25132497, 25134459, 25249015, 25293778, 25300870, 25331939, 25394714, 25500000, 25636473, 25648584, 25686603, 25802333, 25814077, 25828893, 25837664, 25997600, 2614751, 26243622, 26321002, 26375673, 26864341, 27150093, 27229714, 27233483, 27281463, 27437766, 27677634, 27693719, 27824120, 27856601, 27865806, 27894413, 28086219, 28128329, 28186983, 28319094, 28321124, 28386107, 28457753, 28543980, 28599273, 28650474, 28663031, 28673388, 28709134, 28719608, 28748759, 28829353, 28836580, 28923853, 28994041, 29050203, 29299123, 29321163, 29431866, 29437150, 29655153, 29726059, 29859988, 29913272, 29967475, 30042204, 30179268, 30279966, 30334451, 30548479, 30610188, 30619371, 30679796, 30833651, 30864683, 30866043, 31014357, 31136068, 31231484, 31258755, 3129652, 31316003, 31316004, 31338821, 31349760, 31371410, 31493432, 31543464, 31594548, 3165197, 3289649, 6582345, 7521685, 7565705, 7599321, 7665185, 7723413, 7934165, 8124222, 8183938, 8251894, 8251915, 8251918, 8289476, 8396667, 8402896, 8464245, 8652835, 8709625, 8754809, 8853030, 8932497, 9002963, 9050373, 9160683, 9172799, 9196135, 9208849, 9322890, 9536079, 9557610, 9747637, 9879825, 9886327		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	12408765, 14657955, 15723338, 18704194		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	12750174, 21084860	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoid	Lymphoid leukemia	Pubtator	18809762	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	10648417, 11313280, 18519632, 18809762, 25446257, 29967475, 30049824, 9949177	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	28982308	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10480430, 10979973, 12060665, 12446442, 12920036, 15388581, 15607956, 16304046, 18073350, 21275954, 21536647, 2370860, 23806810, 26017033, 26221900, 26438695, 2644988, 2678002, 26802623, 27632978, 28445932, 29286103, 31537905, 3179449, 32588434, 32859541, 32862286, 32871908, 33433047, 33647814, 34053988, 35941390, 36248870, 36307214, 37503586, 37895120, 3866248, 7565761, 8294483, 8562932, 8754809, 9266939, 9473236	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	10583263, 27061824	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Neutrophilic Chronic	Neutrophilic leukemia	Pubtator	9038742, 9886327	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10049047, 10480430, 10706884, 10905055, 11781223, 11896540, 11901483, 12161353, 12363468, 12437659, 12764379, 12908554, 14976243, 15604885, 15920493, 16213359, 16393682, 16490599, 16518848, 16645213, 16916543, 16931578, 17124058, 17391756, 17569777, 18073350, 18467025, 18665825, 19027489, 20809224, 20842730, 22170483, 22691121, 23054652, 23521501, 23666687, 23666688, 24162813, 24791856, 25074248, 25370416, 25401297, 2644988, 2685476, 27297971, 28253536, 28297624, 28322836, 28971504, 29100302, 29286103, 30353413, 30630459, 30635626, 30948162, 31700719, 7723398, 7950925, 8109597, 8242587, 8294483, 8398840, 8616789, 9002963, 9078296, 9266939, 9372085, 9458083		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	17470729		★☆☆☆☆ Found in Text Mining only
Leukemia, Myeloid, Accelerated Phase	Myeloid Leukemia	BEFREE	12646934, 18048643, 23575252		★☆☆☆☆ Found in Text Mining only
Leukemia, Myeloid, Chronic, Atypical, BCR-ABL Negative	Myeloid Leukemia	BEFREE	17764812, 23222956, 24081659, 29226717, 30078497, 30458320, 31594785		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	10586207, 22195406, 22511494, 24164563, 31425923, 8289491		★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	15894930		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	19233941		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Localized scleroderma	Scleroderma	BEFREE	30268392		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	16410245, 17486070		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	26758680		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	29501569		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	11861265, 16205638, 16300960, 17044046, 17554060, 18932238, 20739952, 21822204, 21863287, 22101899, 23399893, 30401948, 30790375, 31173268, 8396667		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10637493, 15739279, 18528425, 21454413, 26285772		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	24060591, 37454239	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	25894969	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	28515100		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	14752867, 15857289, 21178708		★☆☆☆☆ Found in Text Mining only
Macrotia	Macrotia	CLINVAR_DG	28288113		★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development, Group II	Malformation of cortical development	BEFREE	15289338		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10071278, 15483033, 18221038, 20234815, 21480391, 22845480, 23299156, 24960160, 25803821, 26615134, 26838548, 29522716, 29774130		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	20234815		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	21472143		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	23117882		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	19233941		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26615134, 26758680		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23273547		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18831787, 23341502, 24223753		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15382063, 27666407, 31396300		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10706884, 12080468, 12094371, 1467514, 14961028, 15361874, 15739279, 15988530, 16146726, 18401417, 18452548, 18538729, 18539972, 18603297, 19823023, 19939582, 2094324, 21454413, 21722956, 21760961, 21823028, 22021366, 22998183, 23148371, 2334939, 23483480, 24063401, 24246694, 24586514, 24845563, 25183062, 25331939, 25432929, 25490448, 25549138, 25636473, 26053277, 26321002, 26758680, 27229714, 27297971, 27666407, 27821800, 27856601, 27890928, 28241101, 28567073, 28650474, 28657677, 28682832, 28946149, 29022901, 29031704, 29437150, 29455643, 30042204, 30297534, 30684523, 30687103, 30916583, 30965317, 30985947, 31138173, 31295447, 3129652, 31316003, 31533919, 31765478, 3289649, 8656674, 9519773		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27899378		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	20234815		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15857289, 30517893		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18765637		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	20234815		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	20234815		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	24060591		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	19175693		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	35967388	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	23383209	Stimulate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	26615134		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	37963252	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27666407, 31396300		★☆☆☆☆ Found in Text Mining only
Mental Retardation Autosomal Dominant 1	Intellectual developmental disorder	Pubtator	33223528	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	33107354	Associate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	33223528	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Micrognathism	Micrognathism	CLINVAR_DG	28288113		★☆☆☆☆ Found in Text Mining only
Microstomia	Microstomia	CLINVAR_DG	28288113		★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	15860359		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	9473236	Associate	★☆☆☆☆ Found in Text Mining only
Mixed phenotype acute leukemia	Mixed Phenotype Leukemia	BEFREE	10936868, 22372202, 24998463, 30019150		★☆☆☆☆ Found in Text Mining only
Monocytosis	Monocytosis	BEFREE	10583263, 10586207		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	35762721	Associate	★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	21454413		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10222655, 2232886, 22988110, 3049401		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	14632777, 20730794, 26434776, 28087699, 36555805, 37992230	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17824900		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	23469041	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	22537673		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	11530806, 12898186, 15860359, 16321848, 16610578, 16931578, 18467025, 22195406, 22537673, 23010802, 8639433, 9002963		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	12898186, 36307214, 9266939	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic-Myeloproliferative Diseases	Myelodysplastic-Myeloproliferative Diseases	BEFREE	12542482, 20842500, 22511494, 27161873		★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	16321848, 18448166, 19141119, 20425385, 22793267, 25232060, 25520049, 26181658, 26933174, 27017614, 27539616, 27672139, 28335073, 28543980, 29562644, 30879266, 30889303, 8527391, 8908174		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	10480430, 12890867, 16264277, 21125862, 21527514, 25213664		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	LHGDN	12890867, 16448696		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10068681, 10071072, 10071134, 10088201, 10099134, 10190307, 10194128, 10211125, 10224280, 10360384, 10374861, 10374889, 10400414, 10414920, 10431169, 10442632, 10459357, 10475625, 10480429, 10480430, 10492071, 10492072, 10498589, 10498618, 10500825, 10509158, 10520010, 10526530, 10534772, 10549264, 10557048, 10583263, 10583264, 10586207, 10602422, 10615128, 10616282, 10627442, 10629574, 10629590, 10632353, 10637472, 10637493, 10648381, 10658682, 10674911, 10713331, 10739005, 10745258, 10766197, 10784402, 10791539, 10794714, 10812164, 10886215, 10894833, 10899653, 10910073, 10913673, 10931454, 10973491, 10985361, 11091204, 11097354, 11114130, 11122114, 11130241, 11140858, 11150599, 11157490, 11175620, 11175855, 11222387, 11233781, 11238091, 11241795, 11243401, 11255271, 11264164, 11264175, 11284030, 11287973, 11345193, 11345196, 11357705, 11368359, 11369654, 11376866, 11378554, 11425449, 11426628, 11463449, 11480565, 11512149, 11513567, 11516106, 11535505, 11552990, 11559572, 11574931, 11587359, 11697648, 11697649, 11698267, 11710033, 11746971, 11746976, 11750052, 11751374, 11755463, 11777396, 11780326, 11801312, 11840282, 11861294, 11877286, 11896544, 11919386, 11919388, 11919393, 11964320, 11964322, 11979553, 11986206, 11986250, 11986783, 11987244, 12011769, 12015767, 12023981, 12032333, 12036887, 12036890, 12042704, 12075749, 12130516, 12144533, 12145676, 12181044, 12185586, 12187022, 12194988, 12204532, 12215018, 12351420, 12358910, 12373087, 12376083, 12399961, 12400597, 12400616, 12432215, 12454751, 12456669, 12476309, 12483533, 12490207, 12547154, 12552081, 12576334, 12591277, 12606128, 12609962, 12613514, 12623848, 12631253, 12649177, 12656747, 12716364, 12730117, 12743326, 12750174, 12755554, 12759926, 12759927, 12764379, 12781448, 12783368, 12783379, 12783380, 12783977, 12796373, 12823349, 12824897, 12829595, 12835719, 12855552, 12859990, 12866022, 12869662, 12898186, 12902478, 12908554, 12921956, 12960692, 1353550, 1354683, 1371078, 1377943, 14513039, 14523462, 14530811, 14552760, 14635208, 14643293, 14645009, 14656881, 14676625, 14697634, 14712293, 14744784, 14755375, 14961028, 14966468, 14973502, 14976047, 14976243, 14987402, 15050748, 15089759, 15107311, 15109543, 15126353, 15136228, 1515646, 1516023, 1518306, 15190256, 15215876, 15223635, 15236194, 15239390, 15241437, 15255169, 15256429, 15256671, 15282669, 15289338, 15291801, 15309385, 15316326, 15345592, 15359990, 15377489, 15381060, 15389438, 15389825, 15448745, 15481444, 15483033, 15539083, 15571798, 15579919, 15591120, 15621812, 15626746, 15650267, 15654903, 15674331, 15674365, 15676152, 15677719, 15681473, 15703781, 15713800, 15719031, 15721630, 15723338, 15735695, 15739279, 15747376, 15747396, 15749664, 15781610, 15800710, 15806158, 15820950, 15830009, 15833859, 15857289, 15867198, 15899391, 1593904, 1593911, 15949566, 15956284, 15988530, 15993277, 15996933, 16001089, 16001431, 16024645, 16038734, 16079118, 16091111, 16109618, 16130897, 16136169, 16144796, 16157201, 16203287, 16204063, 16207215, 16219545, 16224487, 16230407, 16234522, 16266893, 16278304, 16281073, 16291594, 16291747, 16304378, 16305488, 16319529, 16321848, 16337861, 16337863, 1640725, 16409301, 16426942, 16434489, 16449534, 16461309, 16467199, 16467863, 16475128, 16482210, 16487173, 16487179, 1649356, 16507320, 16518848, 16522812, 16531770, 16541140, 16541397, 16580068, 16585609, 16596225, 16598311, 16598834, 16614241, 16616113, 16616117, 16618932, 16627254, 16631477, 16642048, 16645210, 16651519, 16670264, 16682291, 16683882, 16707599, 16740729, 16757427, 16775234, 16843101, 16849647, 16855631, 16914906, 16932346, 16939497, 16945414, 16952195, 16955467, 16961463, 16982329, 16988930, 16990771, 16998483, 17001000, 17006667, 17008552, 17011977, 17021137, 17044046, 17064224, 17068153, 17071476, 17106019, 17124058, 17130834, 17145570, 17146202, 17179059, 17189224, 17189410, 17208297, 17215855, 17224997, 17236224, 17252012, 17255788, 17284533, 17296565, 17303698, 17350467, 17351342, 17353369, 17363589, 17391756, 17403535, 1742479, 17452251, 17452253, 17457302, 17470736, 17496200, 17498552, 17536018, 17545631, 17550324, 1756463, 17591830, 17599053, 17610380, 17638918, 17656262, 17660274, 17671436, 17671641, 17683977, 17684485, 17688946, 17696194, 17710227, 17717066, 17723177, 17785585, 17853901, 17876770, 17889708, 17891251, 17900686, 17925491, 1794439, 17947479, 17970608, 17979493, 17987804, 17996650, 17998599, 17998637, 17998739, 18032972, 18056186, 18056931, 18067005, 18068536, 18156496, 18158072, 18180382, 18193087, 18202228, 18221038, 18223278, 1824268, 18243808, 18268096, 18276770, 18303987, 18308387, 18346528, 18354488, 18391983, 18397679, 18397680, 18401416, 18406870, 18408710, 18422767, 18426313, 18428043, 18436994, 18448166, 18464118, 18467025, 18474303, 18524993, 18534064, 18537972, 18539972, 18540942, 18566539, 18575724, 18577264, 18577747, 1857987, 18602021, 18603297, 18603549, 18615627, 18628453, 18641042, 18645191, 18665830, 18722880, 18754032, 18766960, 18767145, 18769896, 18796631, 18818391, 18827185, 18828913, 18923436, 1893079, 18936234, 18974832, 18979557, 19039205, 19067742, 19074122, 19091403, 19095773, 19109573, 19141860, 19147089, 19169242, 19175693, 19222642, 19234145, 19237556, 19301661, 19322212, 1932296, 1932752, 1933779, 19340007, 19344397, 19348122, 19357699, 19363292, 19366808, 19383237, 19421140, 19432895, 19458080, 19480935, 19497989, 19506164, 19538165, 19544476, 19565180, 19567163, 19567819, 19567878, 19608684, 1961020, 1961034, 19621546, 19624538, 19625707, 19640586, 19641300, 19641527, 19643477, 19652056, 19652654, 19653139, 19654305, 19698927, 19710400, 19714331, 19723306, 19732723, 19778852, 19798095, 19799626, 19801694, 19806146, 19822896, 19823023, 19837272, 19843886, 19846812, 19855080, 1985690, 19858050, 19878872, 19880502, 19887785, 19924787, 19943786, 19965668, 19966867, 19968720, 19998064, 20007699, 20010464, 20028401, 20038234, 20040619, 20041451, 20047099, 20071983, 20082691, 20101201, 20109350, 20127176, 20130650, 2013977, 2013978, 20141430, 20145140, 20148444, 20153920, 20200561, 20211135, 20228846, 20300999, 20403398, 20413659, 20417871, 20425346, 20425354, 20425399, 20425401, 20425417, 20425449, 20425450, 20445577, 20462961, 20470758, 20491997, 20508029, 20512393, 20519627, 20520635, 20537386, 20564073, 20573399, 20575039, 20607847, 20616057, 20633771, 2065312, 20657522, 20658729, 20658954, 20663870, 20675402, 20697894, 20702476, 20703256, 20720184, 2072739, 20805474, 20809224, 20811403, 20838376, 20844563, 20854875, 20863169, 20875546, 20875551, 20929330, 20949032, 20952060, 20963240, 20963643, 20965785, 20974687, 21071498, 21072051, 21091189, 21098337, 21098700, 21118980, 21123451, 21134983, 21156844, 21198861, 21203397, 21203982, 21220945, 21221851, 21264552, 21266020, 21275954, 21279819, 21293953, 21294709, 21297225, 21299455, 21299457, 21303525, 21338281, 21350558, 21357704, 21373837, 21382639, 21400515, 21431633, 21435002, 21457188, 21468538, 21486895, 21500096, 21503936, 21504383, 21505103, 21511335, 21519342, 21562040, 2157692, 21596859, 21598241, 2164119, 21641753, 21663510, 21672337, 21674858, 21693657, 21693757, 21694468, 21715304, 2171702, 21722956, 21723805, 21739181, 21791426, 21815933, 21826607, 21867983, 21883966, 21884299, 21890458, 21892537, 21892628, 21895409, 21904381, 21911423, 21931114, 21933042, 21944569, 21955823, 2196814, 21986632, 2198962, 21990409, 22005133, 22021366, 22035739, 22038725, 2204477, 22054731, 22057509, 22067393, 22101898, 22116466, 22118744, 22160483, 22169110, 22183070, 22191465, 22207735, 22208485, 22210880, 22231445, 22232214, 22234689, 2223646, 2223647, 22240609, 22248740, 22249155, 22262141, 22262776, 22266405, 22273251, 2227945, 22306673, 22314255, 22328017, 22330069, 22349721, 22372463, 22382182, 22388797, 22395361, 22411871, 22448923, 22460584, 22489663, 22493660, 22521726, 22526369, 22576800, 22585600, 22592606, 22616753, 22617440, 22623184, 22632137, 22641215, 22647531, 2267134, 22691121, 22693568, 22710719, 22749885, 22782217, 22791425, 22797726, 22847163, 22865120, 22870341, 22870928, 22873741, 22887688, 22896000, 22904675, 22912393, 22965919, 22971013, 22985168, 22988110, 22989955, 22992233, 22995644, 23009571, 23036696, 23047475, 23053188, 23062378, 23065514, 23098068, 23127356, 23151810, 23180012, 23190221, 23208504, 23211037, 23233089, 23252482, 23264204, 23275297, 23278256, 2328318, 23284724, 23287430, 23289634, 23299156, 23299311, 23333776, 23341351, 2334939, 23370613, 2337672, 23380743, 23383600, 23399893, 23409026, 23412783, 23417967, 23433665, 23446755, 23458731, 23483480, 23502220, 23515925, 23521501, 23529307, 23543457, 23547655, 23549879, 23550022, 23575252, 23609856, 23613107, 23637631, 23640097, 23642027, 23656643, 23666687, 23666688, 23676790, 23684619, 23716543, 23721517, 23737503, 23759247, 23760739, 23810191, 23810242, 23826126, 23841051, 2386769, 23876601, 23887971, 23894305, 23906051, 23906053, 23965958, 23989453, 24004697, 24012703, 2403827, 24041577, 2405384, 24062017, 24063401, 2406517, 24068564, 2406902, 24072036, 2407300, 24081659, 24091144, 24095735, 24098673, 24100660, 24101380, 24131888, 24162813, 24166712, 24166905, 24206096, 24246694, 24258348, 24260131, 24269846, 24273759, 24280866, 24297946, 24301757, 24308033, 24339928, 2434223, 24349524, 24350829, 24352644, 24357015, 24362263, 24364873, 24365024, 24374144, 24389534, 24441292, 24445143, 24456693, 24456839, 24460325, 24465953, 24482808, 24490604, 24500518, 24504330, 24550512, 24574458, 24588013, 24598853, 24617663, 24619861, 24629639, 24647617, 24680705, 24691568, 24705186, 24705490, 24740226, 24753251, 24766312, 24775308, 24778155, 24779036, 24797802, 24798484, 24806995, 24813417, 24833663, 24837466, 24859364, 2487142, 2487158, 24937675, 24952896, 24967705, 2496773, 2496882, 24969884, 2498881, 24998463, 24998540, 2499863, 25061833, 25105362, 2511093, 25115808, 25127392, 25133686, 25134459, 25169217, 25170123, 25186176, 25196702, 25212276, 25213664, 25216683, 25256677, 25281405, 25293778, 25300870, 25305453, 25311496, 25367136, 25387678, 25389112, 25393253, 25401297, 25410137, 25500000, 25501026, 25515961, 25520136, 25536607, 25547679, 25549138, 25554588, 25573989, 25579165, 25615000, 25648584, 2567002, 25686603, 25700679, 25712455, 25721898, 25730044, 25740611, 25748621, 2578837, 25802333, 25803821, 25814077, 25814088, 25837664, 25840461, 25842192, 25849484, 25880391, 25885255, 25900240, 25913326, 25919613, 25928096, 25941032, 25953263, 25962435, 25976962, 25987039, 25997600, 26059167, 26059983, 26062813, 26072332, 26087013, 26105049, 26111048, 26118315, 26118501, 26147002, 26148723, 26149409, 26151304, 26166664, 26179066, 26186983, 26194865, 26205693, 26218127, 26228085, 26243622, 26252834, 26284455, 26288116, 26290562, 26297264, 26300393, 26304963, 26308792, 26320177, 26391311, 26402671, 26439403, 2644988, 26460262, 26473951, 2649233, 26492355, 26494558, 26501568, 26537529, 26554155, 26563376, 26580245, 26585806, 26587743, 26603839, 26606374, 26607600, 26615134, 26625737, 26631023, 26637731, 26637844, 26667895, 26706195, 26718125, 26726949, 26754830, 2676142, 26773037, 26796903, 26799612, 26831735, 26837312, 26846820, 26847385, 26853281, 26854822, 26857065, 26864341, 26944313, 26946301, 26966074, 26980736, 26985855, 26995693, 26999421, 27018341, 27040932, 27092903, 27101984, 27111338, 27131622, 27132280, 27136541, 27144331, 27150093, 27161125, 27184141, 27198500, 27228340, 27229714, 27233483, 2725497, 27273956, 27281222, 27282563, 27282582, 27291926, 27293081, 27297971, 27329306, 27384990, 27406834, 27412040, 27436342, 27444277, 27454607, 2747638, 27485109, 27537935, 27552202, 27560111, 27562641, 27568522, 27581134, 27581135, 27581136, 27581146, 27581149, 27624943, 27640403, 27643437, 27658269, 27677634, 27686674, 27698265, 27730241, 27769062, 27793879, 27801472, 27810077, 27824120, 27839567, 27852045, 27856601, 27879209, 2788468, 27890856, 27904889, 27908728, 27913475, 27919203, 27924671, 27926512, 27928132, 27957861, 27965460, 27989101, 28035733, 28083711, 28084835, 28086219, 28093990, 28128444, 28135325, 28159740, 28186983, 28212528, 28222016, 28232743, 2825022, 28253493, 28253536, 28273028, 28278078, 28278193, 28283298, 28283735, 28287043, 28295199, 28301600, 28319094, 28323047, 28325357, 28329763, 2833755, 28338290, 28345463, 28369812, 28372728, 28377570, 28396095, 28404889, 28409295, 28416739, 28418880, 28437552, 28444777, 28452984, 28457753, 28458002, 28466557, 28467002, 28475010, 28501737, 28515100, 28523104, 28527402, 28533480, 28534184, 28542127, 28549238, 28556300, 28580869, 28595903, 28599273, 28624216, 28627443, 28631564, 28639894, 28657677, 28673390, 28678800, 28698977, 28719608, 28757617, 28776669, 28778403, 28801986, 28821556, 28828991, 28829353, 2885048, 28902850, 28905209, 2894000, 28942039, 28962554, 28972424, 28986256, 28988389, 28990077, 29022901, 29023488, 29031704, 29051802, 29076384, 29091516, 29100302, 29113191, 29127384, 29152155, 29165716, 29190894, 29266206, 29274688, 29284153, 29284366, 29297244, 29310021, 29312576, 29325229, 29327708, 29358661, 29387948, 29388070, 29388307, 29406237, 29411417, 29414416, 29434953, 29435021, 29442179, 29455643, 29455672, 29459949, 29480034, 29486663, 29500381, 29505034, 29507701, 29511345, 29521048, 29522367, 29541390, 29559564, 29567798, 29569526, 29574182, 29577681, 29608815, 29651584, 29663362, 29668550, 29683667, 29689094, 29691899, 29694669, 29724897, 29725684, 29733872, 29795414, 29808796, 2982232, 29845291, 29845876, 29859988, 29890129, 29905026, 29913272, 29915172, 29951914, 29954936, 29970515, 29974949, 30019447, 30030958, 30042204, 30049824, 30054431, 30054832, 30055114, 30055547, 30057314, 30071761, 30076949, 30078165, 30082224, 30093283, 30093398, 30100996, 30116897, 30120281, 30125955, 30137981, 30153828, 30155588, 30166420, 30167087, 30181422, 30189101, 30195077, 30202081, 3021264, 30217442, 30222247, 30251548, 30267776, 30279966, 30290167, 30317026, 30321462, 30335005, 30347270, 30357754, 30399426, 30409797, 30419548, 30419862, 30423211, 30429156, 30463063, 30465234, 30487792, 30504306, 30511400, 30514753, 30526517, 30574454, 30580670, 30585758, 30587215, 30618318, 30630459, 30675008, 30684523, 30687103, 30687767, 30705677, 30707758, 30711891, 30726713, 30738963, 30755436, 30772299, 30787317, 30798394, 30835732, 30855193, 30864683, 30877503, 30894066, 30897165, 30928650, 30965317, 30991025, 30994506, 31006307, 31014357, 31025148, 31036317, 31054182, 31064152, 31071955, 31101753, 31104089, 31122263, 31123683, 31130253, 31136068, 31138064, 31138265, 31181667, 31187953, 31201085, 31206255, 31208943, 31231484, 31239774, 31258010, 31258755, 31280200, 31286393, 31289206, 31293972, 3129652, 31311809, 31318870, 31338821, 31349760, 31350815, 31371410, 31371419, 31380371, 31399521, 31401626, 31413564, 31422076, 3143116, 31447069, 31448223, 31455852, 31463864, 31488872, 31493432, 31515251, 31518872, 31527518, 31530245, 31542717, 31551508, 31594548, 31594785, 31608223, 31612105, 31638195, 3164635, 31650445, 31669230, 31669399, 31696382, 31701368, 31706847, 31707540, 31717629, 31765938, 31789418, 3179449, 31801582, 31808889, 31810968, 31826340, 31831854, 31837444, 3285291, 3289649, 3313010, 3422516, 3422829, 3455750, 3541203, 3543692, 3856862, 3866248, 6582345, 6960256, 7497436, 7509222, 7512367, 7521685, 7542905, 7542908, 7565705, 7577619, 7579358, 7579359, 7596178, 7600533, 7606740, 7620167, 7621406, 7666834, 7701917, 7718325, 7718887, 7719231, 7723412, 7727789, 7734352, 7758616, 7769362, 7777499, 7786776, 7786800, 7803292, 7808004, 7813429, 7896212, 7896213, 7919323, 7923192, 7934164, 7938018, 7948305, 7957661, 8035612, 8118022, 8124222, 8127150, 8142641, 8142658, 8152300, 8165000, 8180390, 8231240, 8231244, 8231247, 8242587, 8243571, 8251887, 8251903, 8251915, 8251916, 8251917, 8251918, 8282066, 8289478, 8289491, 8298475, 8298481, 8321020, 8321046, 8344852, 8350633, 8374516, 8374529, 8398828, 8398844, 8400243, 8414522, 8417787, 8422466, 8431913, 8457482, 8463127, 8464245, 8483322, 8483329, 8499629, 8500095, 8507874, 8535187, 8536222, 8536245, 8541551, 8542939, 8542954, 8562932, 8580818, 8590842, 8605566, 8608246, 8609723, 8616036, 8625254, 8630427, 8632906, 8637725, 8639431, 8639810, 8649049, 8649822, 8652835, 8656667, 8656674, 8667643, 8684005, 8684009, 8697423, 8697426, 8704208, 8710363, 8750276, 8759898, 8769700, 8781437, 8826888, 8839830, 8841098, 8853030, 8874208, 8882949, 8896419, 8908171, 8908174, 8938137, 8946197, 8998181, 9002963, 9050373, 9054670, 9078292, 9087564, 9090488, 9168433, 9174663, 9181101, 9207469, 9208903, 9209451, 9216726, 9224607, 9266951, 9295046, 9299869, 9306419, 9331565, 9333021, 9341866, 9365838, 9389683, 9389709, 9443047, 9458083, 9458387, 9460506, 9494617, 9519787, 9530344, 9536079, 9552062, 9558370, 9566916, 9593785, 9613984, 9616172, 9665193, 9697888, 9704934, 9716603, 9723035, 9739013, 9746769, 9787174, 9789216, 9792313, 9797777, 9808578, 9809034, 9823946, 9827937, 9844634, 9845542, 9858221, 9858233, 9864172, 9879825		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	CLINVAR_DG	11423618, 11567109, 11569495, 11853795, 11861307, 11964322, 12130516, 12399961, 12576318, 12623848, 12783380, 14559829, 14745431, 15194504, 15256422, 15381060, 15510211, 17008892, 17114651, 17189410, 18223278, 18354488, 18757400, 18828913, 19164531, 19264234, 19466505, 19557636, 19652056, 19768693, 19811824, 20010464, 20367437, 20512393, 20537386, 20557306, 20607847, 20697894, 20702476, 20963643, 21221851, 21489624, 21505103, 21509757, 21562040, 21605905, 21762985, 21872826, 21888027, 21895409, 22210874, 22306673, 22870928, 22912393, 23355941, 23540562, 23575252, 23676790, 24109527, 24236021, 24456693, 25152116, 25157968		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	LHGDN	12130516, 12144533, 12408765, 12505259, 12781448, 15583852, 15626746, 15716990, 17268511, 17303698, 17470736, 17579186, 17638918, 17768119, 18089786, 18262060, 19048492, 19061839		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	CTD_human_DG	15604220, 18673174, 21908430		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	CGI_DG			★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	10500825, 10910073, 11243401, 12483110, 12483533, 12667992, 12855552, 14966468, 14976047, 15505216, 15723338, 16225651, 16230407, 16321848, 16670266, 16777224, 17194663, 17230231, 17249502, 17255788, 17545631, 17996650, 18024651, 18158285, 18300758, 18528425, 18566326, 18577264, 18754027, 18757400, 18767145, 18769448, 18937974, 18971950, 18979557, 19109573, 19147089, 19175693, 19262601, 19605820, 19658100, 19858050, 19959796, 20002154, 20085582, 20214447, 20425385, 20445018, 20472827, 20560681, 21220604, 21245760, 21299455, 21474922, 21527514, 21646683, 21723416, 21742423, 21823028, 21892537, 22035746, 22160036, 22170483, 22328017, 22460584, 22511494, 22513837, 22793267, 22847163, 22864358, 22917768, 22948537, 23010802, 23186533, 23211037, 23233154, 23349688, 23558526, 23656643, 23748344, 23781511, 23863895, 23872309, 23883175, 23978506, 23986553, 24190690, 24309205, 24441292, 24475114, 24504330, 24629639, 24927924, 25151955, 25227185, 25232060, 25349114, 25520049, 25807961, 25840747, 25932444, 25997600, 26071474, 26181658, 26182311, 26284455, 26331539, 26361084, 26370832, 26440973, 26563376, 26933174, 27017614, 27039813, 27077777, 27161873, 27229714, 27258562, 27447873, 27624943, 27672139, 27739437, 27756071, 27924369, 28159740, 28298076, 28340692, 28370510, 28406068, 28415571, 28497580, 28543980, 28554272, 28556926, 28559287, 28902850, 28914569, 28990497, 29134817, 29256926, 29288910, 29327708, 29500381, 29560522, 29611379, 29693647, 29845291, 29975001, 30030958, 30084272, 30084669, 30103245, 30155552, 30353413, 30463063, 30553471, 30581159, 30769020, 30772299, 30833651, 30889303, 30965317, 30967632, 31122263, 31138064, 31206255, 31340059, 31413564, 31450973, 31732720, 31765478, 31837444, 8908171		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	16225651, 16304380, 17249502, 17644735, 18757400, 19109573, 21318952, 22511494, 23599815, 26291129, 29500381, 33541399, 3866076, 7565761, 9038742	Associate	★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	23989453		★☆☆☆☆ Found in Text Mining only
Nail-Patella Syndrome	Nail-Patella Syndrome	BEFREE	9781017		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	29914565		★☆☆☆☆ Found in Text Mining only
Nausea	Nausea	Pubtator	28224300	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	14645012	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10597306, 10764152, 11790557, 11904740, 11919386, 12032333, 12829595, 12960692, 14510942, 14530811, 14656881, 15282669, 15382063, 15492510, 15725478, 16448696, 16531770, 16618932, 16885384, 17071476, 17296565, 17344919, 17703068, 18089779, 18181176, 18193087, 18615627, 19357699, 19432895, 19458080, 19554484, 19654305, 19878872, 19959093, 19965668, 20940029, 21454413, 21693657, 2182595, 21892628, 22035746, 22543587, 22632137, 22646772, 22797726, 23208504, 23287430, 23575065, 23656643, 23989453, 24095735, 24173087, 24647617, 25196073, 25293778, 26285772, 26758680, 26804638, 26864341, 27184141, 28212528, 28253536, 28319094, 28667884, 28776669, 28804122, 29691899, 29696694, 29774130, 30078497, 30297534, 30458320, 30956771, 31425923, 31518872, 31539241, 31638195, 31666936, 7590236, 7690441, 8152300, 8282066, 8408711, 8527391, 9683357, 9926930		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	14704656, 15329907, 15749664, 15920493, 16883592, 17728783, 26138637, 28125812, 28567073, 28994041		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	7565761	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	25264277, 37664946	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	31755389, 36552734	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	24412932, 31755389		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	27624943, 31130253		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10911621, 17891251, 22845480, 26758680		★☆☆☆☆ Found in Text Mining only
Osteosclerosis	Osteosclerosis	BEFREE	29560522		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	23273547		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	12910520, 12928725, 19738611	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25111230	Associate	★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	18343792, 27539616		★☆☆☆☆ Found in Text Mining only
Papillary renal cell carcinoma type 2	Papillary Renal Carcinoma	BEFREE	30297534		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	12679488, 2594368, 9333021		★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	12239143	Inhibit	★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	32667912	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	24412932, 28078567		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	36552734	Associate	★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	23143281		★☆☆☆☆ Found in Text Mining only
Perineurioma	Perineurioma	BEFREE	25074247		★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	LHGDN	12408765		★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	BEFREE	22234689		★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	Pubtator	26187587	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	LHGDN	12408765		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	14966468, 16321848, 17194663, 17255788, 17979493, 18024651, 18769448, 18937974, 19109573, 19167611, 19843380, 20002154, 20499211, 20560681, 22035746, 22234689, 22793267, 22847163, 23233154, 23986553, 25349114, 26492355, 26933174, 27017614, 27039813, 28406068, 29134817, 29611379, 31340059, 8527391		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	19109573, 19484334, 26187587, 27111338, 28335073, 29611379, 38386293	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	30889303	Inhibit	★☆☆☆☆ Found in Text Mining only
Portal Vein Thrombosis	Portal Vein Thrombosis	BEFREE	28559287		★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	10602422, 18704194, 20979181, 23171811, 24729118, 24821775, 25337274, 30181314, 8317466		★☆☆☆☆ Found in Text Mining only
Precursor B-cell acute lymphoblastic leukemia	Lymphoblastic Leukemia	Orphanet			★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	11861265, 12791662, 14603332, 14993251, 15505216, 15681433, 15713800, 17077147, 18704194, 18815194, 19322212, 19965668, 20082857, 20666852, 21242186, 21435002, 21863287, 21884299, 22234689, 23098889, 23171811, 23399893, 23491079, 23521501, 24215620, 24244612, 24729118, 25337274, 25775523, 26266519, 26588464, 28063378, 28652370, 28804122, 28818808, 29199525, 29531323, 30038712, 30181314, 30991025, 31173268, 31601692, 8667652, 9172811, 9369422		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	ORPHANET_DG	23491079		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	10602422, 11861265, 14993251, 18704194, 20082857, 23098889, 24729118, 29531323, 8667652		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	10037003, 10374861, 10459357, 10500826, 10640143, 10654022, 11287973, 11369654, 11801312, 11861265, 11861307, 12040449, 12399961, 12447959, 12960692, 15315963, 15721638, 15789066, 15820957, 16157197, 16205638, 16300960, 16523310, 16572268, 16618932, 18253707, 18519632, 18603297, 18722880, 19027489, 19095773, 19322212, 19587702, 19589926, 19608682, 19759560, 19770381, 19816207, 20534699, 20633771, 21178708, 21822204, 21863287, 22005133, 22021366, 22134481, 22587422, 22591684, 22997141, 2334939, 23804397, 23881917, 23911702, 24280866, 24319172, 24366361, 24444868, 24468836, 24997151, 25261097, 26050650, 26321221, 27229714, 27447561, 2747638, 27821800, 28103625, 28444777, 28451802, 28579617, 28581459, 29177615, 29219890, 29434963, 29726059, 30028819, 30121665, 30300827, 30401948, 30546081, 30675008, 30790375, 31173268, 3118359, 31295447, 31563145, 3283653, 3289649, 7521685, 7564511, 7777499, 8142658, 8542955, 8608244, 9372085, 9585083, 9648560, 9787174, 9973946		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	CTD_human_DG	11984797, 21898527		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	15716990, 16205638, 16386788, 17541395, 17761812, 17762503		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	CGI_DG			★☆☆☆☆ Found in Text Mining only
Precursor T-cell acute lymphoblastic leukemia	Lymphoblastic Leukemia	Orphanet			★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	11170285, 15282669, 15361874, 15713800, 16213363, 16777224, 16873673, 17369128, 17488685, 17569777, 18185524, 18322257, 18401417, 18784740, 18835836, 18923437, 20073070, 20423567, 21435002, 22689211, 23872305, 30803551, 31136068, 9760154		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	ORPHANET_DG	29279377		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	CGI_DG			★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	16321848, 17285276, 18024651, 18448166, 18769448, 18937974, 19141119, 20002154, 20560681, 21220604, 22035746, 22170483, 22793267, 23233154, 23986553, 24190690, 25232060, 25349114, 25520049, 26181658, 26182311, 26492355, 26933174, 27017614, 27039813, 27539616, 27672139, 27756071, 28335073, 28499938, 28543980, 28914569, 29134817, 29256926, 29560522, 29562644, 30612065, 30879266, 30889303, 8527391, 8908174		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18831787, 24223753		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20881409, 22075945, 24223753	Associate	★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	28224300	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	BEFREE	10931454		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	31298930		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	10102629		★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid tumor	Pubtator	20629032	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	19451690, 25472975		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	19180499	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	31765478, 9783805		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	20724541		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	17768128		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	17768128	Associate	★☆☆☆☆ Found in Text Mining only
Splanchnic vein thrombosis	Splanchnic vein thrombosis	BEFREE	25840747		★☆☆☆☆ Found in Text Mining only
Splenomegaly	Splenomegaly	Pubtator	21804629	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23146907, 28984303, 37169211	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	17543081		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15382063, 27666407, 31396300		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	34585958	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26429164, 34585958	Associate	★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	10931454		★☆☆☆☆ Found in Text Mining only
Symmetrical dyschromatosis of extremities	Symmetrical Dyschromatosis Of Extremities	BEFREE	23621630		★☆☆☆☆ Found in Text Mining only
Syndactyly	Syndactyly	GENOMICS_ENGLAND_DG	28288113		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	21321929		★☆☆☆☆ Found in Text Mining only
T-Cell Prolymphocytic Leukemia	T-Cell Prolymphocytic Leukemia	BEFREE	25217890		★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	27111338, 28335073, 28406068, 28415571, 30602717, 9326244	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	10194123, 11296785, 11342314, 14966468, 16321848, 16682291, 17285276, 18024651, 18769448, 18937974, 20002154, 2065312, 22035746, 22170483, 22793267, 22847163, 23986553, 26754830, 26933174, 27486987, 28335073, 28406068, 28415571, 29134817, 29560522, 29845291, 30612065, 31340059, 7718325, 8527391, 8684009, 8689617, 9326244, 9460506		★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	LHGDN	14966468		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	21804629, 28224300, 35731275	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	BEFREE	12187022, 16321848, 28437552, 29187020, 8684009, 8759898, 9519786		★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	Pubtator	28437552, 34477162, 36354705	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	37983208	Stimulate	★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	8396667		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	12679488, 9595037		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24789045, 25803821, 39819723	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25803821, 25883211		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28661474	Inhibit	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	2889832	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	7590733		★☆☆☆☆ Found in Text Mining only
TUBEROUS SCLEROSIS 1 (disorder)	Tuberous Sclerosis	BEFREE	7590733		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33952249	Associate	★☆☆☆☆ Found in Text Mining only
Venous malformation	Venous malformation	BEFREE	30626204		★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	HPO_DG			★☆☆☆☆ Found in Text Mining only
Warburg Sjo Fledelius syndrome	Warburg Micro Syndrome	BEFREE	18413245		★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	21123451		★☆☆☆☆ Found in Text Mining only
Xeroderma pigmentosum variant type	Xeroderma pigmentosum	Pubtator	15050919	Associate	★☆☆☆☆ Found in Text Mining only