Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2495
Gene name	Ferritin heavy chain 1
Gene symbol	FTH1
Synonyms (NCBI Gene)	FHCFTHFTHL6HFE5NBIA9PIG15PLIF
Chromosome	11
Chromosome location	11q12.3
Summary	This gene encodes the heavy subunit of ferritin, the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rat

147

Show/Hide all (147)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030032	hsa-miR-26b-5p	Microarray	19088304
MIRT031951	hsa-miR-16-5p	Proteomics	18668040
MIRT050899	hsa-miR-17-5p	CLASH	23622248
MIRT036560	hsa-miR-941	CLASH	23622248
MIRT574177	hsa-miR-6771-3p	PAR-CLIP	20371350
MIRT574175	hsa-miR-548m	PAR-CLIP	20371350
MIRT574176	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT574174	hsa-miR-548ag	PAR-CLIP	20371350
MIRT574173	hsa-miR-548ai	PAR-CLIP	20371350
MIRT574172	hsa-miR-548ba	PAR-CLIP	20371350
MIRT574171	hsa-miR-570-5p	PAR-CLIP	20371350
MIRT574170	hsa-miR-4496	PAR-CLIP	20371350
MIRT518720	hsa-miR-3133	PAR-CLIP	23446348
MIRT518719	hsa-miR-551b-5p	PAR-CLIP	23446348
MIRT518718	hsa-miR-3606-3p	PAR-CLIP	23446348
MIRT518717	hsa-miR-513a-3p	PAR-CLIP	23446348
MIRT518716	hsa-miR-513c-3p	PAR-CLIP	23446348
MIRT518715	hsa-miR-4511	PAR-CLIP	23446348
MIRT518714	hsa-miR-5579-5p	PAR-CLIP	23446348
MIRT518713	hsa-miR-1252-5p	PAR-CLIP	23446348
MIRT518712	hsa-miR-4790-3p	PAR-CLIP	23446348
MIRT518711	hsa-miR-6126	PAR-CLIP	23446348
MIRT518710	hsa-miR-6864-5p	PAR-CLIP	23446348
MIRT574177	hsa-miR-6771-3p	PAR-CLIP	20371350
MIRT574175	hsa-miR-548m	PAR-CLIP	20371350
MIRT574176	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT574174	hsa-miR-548ag	PAR-CLIP	20371350
MIRT574173	hsa-miR-548ai	PAR-CLIP	20371350
MIRT574172	hsa-miR-548ba	PAR-CLIP	20371350
MIRT574171	hsa-miR-570-5p	PAR-CLIP	20371350
MIRT574170	hsa-miR-4496	PAR-CLIP	20371350
MIRT518720	hsa-miR-3133	PAR-CLIP	23446348
MIRT518719	hsa-miR-551b-5p	PAR-CLIP	23446348
MIRT518718	hsa-miR-3606-3p	PAR-CLIP	23446348
MIRT518717	hsa-miR-513a-3p	PAR-CLIP	23446348
MIRT518716	hsa-miR-513c-3p	PAR-CLIP	23446348
MIRT518715	hsa-miR-4511	PAR-CLIP	23446348
MIRT518714	hsa-miR-5579-5p	PAR-CLIP	23446348
MIRT518713	hsa-miR-1252-5p	PAR-CLIP	23446348
MIRT518712	hsa-miR-4790-3p	PAR-CLIP	23446348
MIRT518711	hsa-miR-6126	PAR-CLIP	23446348
MIRT518710	hsa-miR-6864-5p	PAR-CLIP	23446348
MIRT1005644	hsa-miR-1225-5p	CLIP-seq
MIRT1005645	hsa-miR-1252	CLIP-seq
MIRT1005646	hsa-miR-1263	CLIP-seq
MIRT1005647	hsa-miR-2052	CLIP-seq
MIRT1005648	hsa-miR-2110	CLIP-seq
MIRT1005649	hsa-miR-224	CLIP-seq
MIRT1005650	hsa-miR-3675-5p	CLIP-seq
MIRT1005651	hsa-miR-3681	CLIP-seq
MIRT1005652	hsa-miR-3691-5p	CLIP-seq
MIRT1005653	hsa-miR-4271	CLIP-seq
MIRT1005654	hsa-miR-4307	CLIP-seq
MIRT1005655	hsa-miR-4312	CLIP-seq
MIRT1005656	hsa-miR-4636	CLIP-seq
MIRT1005657	hsa-miR-4725-3p	CLIP-seq
MIRT1005658	hsa-miR-4764-5p	CLIP-seq
MIRT1005646	hsa-miR-1263	CLIP-seq
MIRT1005647	hsa-miR-2052	CLIP-seq
MIRT1005649	hsa-miR-224	CLIP-seq
MIRT1005651	hsa-miR-3681	CLIP-seq
MIRT1005652	hsa-miR-3691-5p	CLIP-seq
MIRT1005654	hsa-miR-4307	CLIP-seq
MIRT1005655	hsa-miR-4312	CLIP-seq
MIRT1005658	hsa-miR-4764-5p	CLIP-seq
MIRT1005645	hsa-miR-1252	CLIP-seq
MIRT1005646	hsa-miR-1263	CLIP-seq
MIRT1005647	hsa-miR-2052	CLIP-seq
MIRT1005648	hsa-miR-2110	CLIP-seq
MIRT1005649	hsa-miR-224	CLIP-seq
MIRT1005650	hsa-miR-3675-5p	CLIP-seq
MIRT1005651	hsa-miR-3681	CLIP-seq
MIRT1005652	hsa-miR-3691-5p	CLIP-seq
MIRT1005653	hsa-miR-4271	CLIP-seq
MIRT1005654	hsa-miR-4307	CLIP-seq
MIRT1005655	hsa-miR-4312	CLIP-seq
MIRT1998038	hsa-miR-4427	CLIP-seq
MIRT1998039	hsa-miR-4680-3p	CLIP-seq
MIRT1998040	hsa-miR-4691-3p	CLIP-seq
MIRT1005657	hsa-miR-4725-3p	CLIP-seq
MIRT1005658	hsa-miR-4764-5p	CLIP-seq
MIRT2231647	hsa-miR-1228	CLIP-seq
MIRT1005645	hsa-miR-1252	CLIP-seq
MIRT1005646	hsa-miR-1263	CLIP-seq
MIRT1005647	hsa-miR-2052	CLIP-seq
MIRT1005648	hsa-miR-2110	CLIP-seq
MIRT1005649	hsa-miR-224	CLIP-seq
MIRT2231648	hsa-miR-3129-3p	CLIP-seq
MIRT1005650	hsa-miR-3675-5p	CLIP-seq
MIRT1005651	hsa-miR-3681	CLIP-seq
MIRT1005652	hsa-miR-3691-5p	CLIP-seq
MIRT2231649	hsa-miR-3920	CLIP-seq
MIRT2231650	hsa-miR-3940-3p	CLIP-seq
MIRT1005653	hsa-miR-4271	CLIP-seq
MIRT1005654	hsa-miR-4307	CLIP-seq
MIRT1005655	hsa-miR-4312	CLIP-seq
MIRT1005657	hsa-miR-4725-3p	CLIP-seq
MIRT2231651	hsa-miR-4733-5p	CLIP-seq
MIRT2231652	hsa-miR-4762-3p	CLIP-seq
MIRT1005658	hsa-miR-4764-5p	CLIP-seq
MIRT1005646	hsa-miR-1263	CLIP-seq
MIRT1005647	hsa-miR-2052	CLIP-seq
MIRT1005648	hsa-miR-2110	CLIP-seq
MIRT1005649	hsa-miR-224	CLIP-seq
MIRT1005650	hsa-miR-3675-5p	CLIP-seq
MIRT1005651	hsa-miR-3681	CLIP-seq
MIRT1005652	hsa-miR-3691-5p	CLIP-seq
MIRT1005653	hsa-miR-4271	CLIP-seq
MIRT1005654	hsa-miR-4307	CLIP-seq
MIRT1005655	hsa-miR-4312	CLIP-seq
MIRT1005657	hsa-miR-4725-3p	CLIP-seq
MIRT1005658	hsa-miR-4764-5p	CLIP-seq
MIRT1005644	hsa-miR-1225-5p	CLIP-seq
MIRT1005645	hsa-miR-1252	CLIP-seq
MIRT1005646	hsa-miR-1263	CLIP-seq
MIRT1005647	hsa-miR-2052	CLIP-seq
MIRT1005651	hsa-miR-3681	CLIP-seq
MIRT1005652	hsa-miR-3691-5p	CLIP-seq
MIRT1005654	hsa-miR-4307	CLIP-seq
MIRT1005655	hsa-miR-4312	CLIP-seq
MIRT1005658	hsa-miR-4764-5p	CLIP-seq
MIRT2231647	hsa-miR-1228	CLIP-seq
MIRT1998040	hsa-miR-4691-3p	CLIP-seq
MIRT2231647	hsa-miR-1228	CLIP-seq
MIRT1005648	hsa-miR-2110	CLIP-seq
MIRT1005649	hsa-miR-224	CLIP-seq
MIRT2231648	hsa-miR-3129-3p	CLIP-seq
MIRT2535543	hsa-miR-3591-5p	CLIP-seq
MIRT1005650	hsa-miR-3675-5p	CLIP-seq
MIRT2231650	hsa-miR-3940-3p	CLIP-seq
MIRT2535544	hsa-miR-3978	CLIP-seq
MIRT2535545	hsa-miR-4261	CLIP-seq
MIRT1005653	hsa-miR-4271	CLIP-seq
MIRT1005655	hsa-miR-4312	CLIP-seq
MIRT2535546	hsa-miR-4320	CLIP-seq
MIRT2535547	hsa-miR-4494	CLIP-seq
MIRT2535548	hsa-miR-4522	CLIP-seq
MIRT1005656	hsa-miR-4636	CLIP-seq
MIRT2535549	hsa-miR-4724-5p	CLIP-seq
MIRT1005657	hsa-miR-4725-3p	CLIP-seq
MIRT2535550	hsa-miR-4764-3p	CLIP-seq
MIRT2535551	hsa-miR-4782-5p	CLIP-seq
MIRT2535552	hsa-miR-494	CLIP-seq
MIRT2535553	hsa-miR-499a-5p	CLIP-seq
MIRT2535554	hsa-miR-648	CLIP-seq
MIRT2231647	hsa-miR-1228	CLIP-seq
MIRT2231648	hsa-miR-3129-3p	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
ATF1	Activation	17565989
ATF1	Repression	17565989

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004322	Function	Ferroxidase activity	IEA
GO:0004322	Function	Ferroxidase activity	IMP	9003196
GO:0005506	Function	Iron ion binding	TAS	3020541
GO:0005515	Function	Protein binding	IPI	15607035, 16169070, 16189514, 17355907, 20133674, 20195357, 21516116, 21573799, 21653829, 21988832, 22458338, 25277244, 25327288, 25416956, 25910212, 28514442, 31515488, 32296183, 33961781
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005776	Component	Autophagosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006826	Process	Iron ion transport	IBA
GO:0006826	Process	Iron ion transport	IEA
GO:0006879	Process	Intracellular iron ion homeostasis	IEA
GO:0006879	Process	Intracellular iron ion homeostasis	TAS	6589621
GO:0006955	Process	Immune response	ISS
GO:0008198	Function	Ferrous iron binding	IBA
GO:0008198	Function	Ferrous iron binding	IMP	9003196
GO:0008199	Function	Ferric iron binding	IBA
GO:0008199	Function	Ferric iron binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	ISS
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 31515488, 33087927
GO:0044754	Component	Autolysosome	IDA	25327288
GO:0046872	Function	Metal ion binding	IEA
GO:0048147	Process	Negative regulation of fibroblast proliferation	IDA	9924025
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070288	Component	Ferritin complex	TAS	6589621
GO:0110076	Process	Negative regulation of ferroptosis	IMP	26403645
GO:0140315	Function	Iron ion sequestering activity	IDA	9924025
GO:1904724	Component	Tertiary granule lumen	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
134770	3976	ENSG00000167996

P02794

Protein name

Ferritin heavy chain (Ferritin H subunit) (EC 1.16.3.1) (Cell proliferation-inducing gene 15 protein) [Cleaved into: Ferritin heavy chain, N-terminally processed]

Protein function

Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity (PubMed:9003196). Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation (PubMed:9003196). Als

PDB

1FHA , 2CEI , 2CHI , 2CIH , 2CLU , 2CN6 , 2CN7 , 2FHA , 2IU2 , 2Z6M , 3AJO , 3AJP , 3AJQ , 3ERZ , 3ES3 , 4DYX , 4DYY , 4DYZ , 4DZ0 , 4OYN , 4Y08 , 4YKH , 4ZJK , 5CMQ , 5CMR , 5GN8 , 5GOU , 5JKK , 5JKL , 5JKM , 5N26 , 5N27 , 5UP7 , 5UP8 , 5UP9 , 5VTD , 5XB1 , 5YI5 , 5ZND , 6B8F , 6B8G , 6FTV , 6GSR , 6H5I , 6H6T , 6H6U , 6IPC , 6IPO , 6IPP , 6IPQ , 6J4A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00210	Ferritin	18 → 159	Ferritin-like domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the liver. {ECO:0000269|PubMed:11389486}.

Sequence

MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQS
HEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHK
LATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSD
NES

Sequence length

183

Interactions

View interactions

	KEGG		Reactome
	Porphyrin metabolism Ferroptosis Necroptosis Mineral absorption		Golgi Associated Vesicle Biogenesis Neutrophil degranulation Iron uptake and transport

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Hemochromatosis type 5	Pathogenic	rs387906549	RCV001823872	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodegeneration with brain iron accumulation 9	Pathogenic	rs2541427923, rs2541427837	RCV003482890 RCV003482891	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (23)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTOSOMAL DOMINANT VITREORETINOCHOROIDOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BESTROPHINOPATHY, AUTOSOMAL RECESSIVE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEGENERATIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FTH1-related disorder	Uncertain significance; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMOCHROMATOSIS, TYPE 5	—	CTD, HPO CTD, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRON METABOLISM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Iron Overload	Uncertain significance	ClinVar CTD, Disgenet CTD, Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
IRON OVERLOAD, AUTOSOMAL DOMINANT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATION WITH BRAIN IRON ACCUMULATION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINITIS PIGMENTOSA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINITIS PIGMENTOSA, CONCENTRIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (115)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	19531652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	12220473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	27804118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28652739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	31491006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28652739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	28730787		★★★★★ ★☆☆☆☆ Found in Text Mining only
BESTROPHINOPATHY, AUTOSOMAL RECESSIVE	Bestrophinopathy	CLINVAR_DG	19375515		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain neoplasms	Pubtator	28837569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11299801, 22997041, 29455519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34551213, 37390841	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	19423691	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32476555	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24066693, 32476555, 33864445, 37008632, 37248280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	38393890	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33864445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	38025678	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	37914703	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28011936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24743703, 31245295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20524204, 25824771, 28982866, 29368506, 30890168, 31245295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37086630	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	CTD_human_DG	25724174		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31104064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	32743916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	40527798	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Central Nervous System	Degenerative Diseases, Central Nervous System	CTD_human_DG	15964507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Spinal Cord	Degenerative Diseases, Central Nervous System	CTD_human_DG	15964507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	24448401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression, Neurotic	Mental Depression	CTD_human_DG	17063146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	CTD_human_DG	17063146		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Syndrome	Mental Depression	CTD_human_DG	17063146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	37660254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37150518	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	35162984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endogenous depression	Mental Depression	CTD_human_DG	17063146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	37660254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	33176591	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	24327207		★★★★★ ★☆☆☆☆ Found in Text Mining only
FTH1-related iron overload	Iron Overload	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31491006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31491006, 33420375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31491006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	CTD_human_DG	21385903		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	30221720		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	31491006, 33864445, 36164395	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glucocorticoid deficiency with achalasia	Glucocorticoid Deficiency With Achalasia	BEFREE	19855093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	LHGDN	11783942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	BEFREE	1757092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	40643497	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	193524, 3855405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperferritinemia	Hyperferritinemia	Pubtator	36183555	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	193524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	38012716	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	39789492	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	CTD_human_DG	11389486		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Iron Overload	Iron Overload	LHGDN	15727900		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Iron Overload	Iron Overload	BEFREE	24327207, 8009283		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Iron Overload	Iron overload	Pubtator	37914703	Associate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Iron Overload, Autosomal Dominant	Iron Overload	GENOMICS_ENGLAND_DG	11389486		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Iron Overload, Autosomal Dominant	Iron Overload	ORPHANET_DG	11389486		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Iron Overload, Autosomal Dominant	Iron Overload	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Iron Overload, Autosomal Dominant	Iron Overload	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratoconus	Keratoconus	Pubtator	11683372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29923765, 30833408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30325535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24066693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	32476555	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31755376	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	30344652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	38025726	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	19258503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	18987541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	CTD_human_DG	21385903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	26818092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11299801, 22997041, 29455519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28730787, 29240947, 30610587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30274235, 30339945, 31104064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	24743703, 31245295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	CTD_human_DG	17063146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	31442913, 31755376	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	31491006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
mixed gliomas	Glioma	CTD_human_DG	21385903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	39261934	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25824771, 26960542, 27732930, 29505243, 31245295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	27732930, 30914192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	37660254	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	CTD_human_DG	15964507		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroferritinopathy	Neuroferritinopathy	BEFREE	21029774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29459183	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37914703	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	38287843	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30427936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27566559	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36061308	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	30446371, 31467572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	35162984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	40057801	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pontocerebellar Hypoplasia	Pontocerebellar hypoplasia	Pubtator	37660254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14654946, 28730787, 29240947, 30610587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	28730787	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	10554036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28730787, 36806086, 37894914	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31104064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30804939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylolisthesis	Spondylolisthesis	BEFREE	31129223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30674089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33864445, 34853622, 36012290, 38025726	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	30655769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	38393890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24742827, 30102404, 34551213, 37822991	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30102404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	CTD_human_DG	17063146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitelliform Macular Dystrophy	Vitelliform Macular Dystrophy	CLINVAR_DG	21467170, 24560797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitelliform Macular Dystrophy	Vitelliform macular dystrophy	Pubtator	9445487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FTH1 (ferritin heavy chain 1)