ALOX15 (arachidonate 15-lipoxygenase)

Gene

• Entrez ID: 246
• Gene name: Arachidonate 15-lipoxygenase
• Gene symbol: ALOX15
• Synonyms (NCBI Gene): 12-LOX, 15-LOX, 15-LOX-1, LOG15
• Chromosome: 17
• Chromosome location: 17p13.2
• Summary: This gene encodes a member of the lipoxygenase family of proteins. The encoded enzyme acts on various polyunsaturated fatty acid substrates to generate various bioactive lipid mediators such as eicosanoids, hepoxilins, lipoxins, and other molecules. The e

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT437575	hsa-miR-203a-3p	Microarray, qRT-PCR	22815788
MIRT541602	hsa-miR-4432	PAR-CLIP	21572407
MIRT541601	hsa-miR-451b	PAR-CLIP	21572407
MIRT541599	hsa-miR-6501-3p	PAR-CLIP	21572407
MIRT541600	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT541598	hsa-miR-6742-3p	PAR-CLIP	21572407
MIRT541597	hsa-miR-6776-5p	PAR-CLIP	21572407
MIRT541596	hsa-miR-4696	PAR-CLIP	21572407
MIRT541595	hsa-miR-363-5p	PAR-CLIP	21572407
MIRT541594	hsa-miR-6745	PAR-CLIP	21572407
MIRT541593	hsa-miR-6756-5p	PAR-CLIP	21572407
MIRT541592	hsa-miR-6766-5p	PAR-CLIP	21572407
MIRT541591	hsa-miR-1293	PAR-CLIP	21572407
MIRT541590	hsa-miR-4483	PAR-CLIP	21572407
MIRT541589	hsa-miR-6512-3p	PAR-CLIP	21572407
MIRT541588	hsa-miR-6720-5p	PAR-CLIP	21572407
MIRT451512	hsa-miR-302f	PAR-CLIP	23592263
MIRT451511	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT451510	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT451509	hsa-miR-940	PAR-CLIP	23592263
MIRT451508	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT451507	hsa-miR-665	PAR-CLIP	23592263
MIRT451506	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT451505	hsa-miR-219b-3p	PAR-CLIP	23592263
MIRT451504	hsa-miR-1827	PAR-CLIP	23592263
MIRT451503	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT451502	hsa-miR-139-3p	PAR-CLIP	23592263
MIRT451501	hsa-miR-1273e	PAR-CLIP	23592263
MIRT541602	hsa-miR-4432	PAR-CLIP	21572407
MIRT541601	hsa-miR-451b	PAR-CLIP	21572407
MIRT541599	hsa-miR-6501-3p	PAR-CLIP	21572407
MIRT541600	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT541598	hsa-miR-6742-3p	PAR-CLIP	21572407
MIRT541597	hsa-miR-6776-5p	PAR-CLIP	21572407
MIRT541596	hsa-miR-4696	PAR-CLIP	21572407
MIRT541595	hsa-miR-363-5p	PAR-CLIP	21572407
MIRT541594	hsa-miR-6745	PAR-CLIP	21572407
MIRT541593	hsa-miR-6756-5p	PAR-CLIP	21572407
MIRT541592	hsa-miR-6766-5p	PAR-CLIP	21572407
MIRT541591	hsa-miR-1293	PAR-CLIP	21572407
MIRT541590	hsa-miR-4483	PAR-CLIP	21572407
MIRT541589	hsa-miR-6512-3p	PAR-CLIP	21572407
MIRT541588	hsa-miR-6720-5p	PAR-CLIP	21572407
MIRT451512	hsa-miR-302f	PAR-CLIP	23592263
MIRT451511	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT451510	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT451509	hsa-miR-940	PAR-CLIP	23592263
MIRT451508	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT451507	hsa-miR-665	PAR-CLIP	23592263
MIRT451506	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT451505	hsa-miR-219b-3p	PAR-CLIP	23592263
MIRT451504	hsa-miR-1827	PAR-CLIP	23592263
MIRT451503	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT451502	hsa-miR-139-3p	PAR-CLIP	23592263
MIRT451501	hsa-miR-1273e	PAR-CLIP	23592263
MIRT755579	hsa-miR-660-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunofluorescence	37425043
MIRT778866	hsa-miR-1225-3p	CLIP-seq
MIRT778867	hsa-miR-1233	CLIP-seq
MIRT778868	hsa-miR-203	CLIP-seq
MIRT778869	hsa-miR-2114	CLIP-seq
MIRT778870	hsa-miR-3065-5p	CLIP-seq
MIRT778871	hsa-miR-3120-5p	CLIP-seq
MIRT778872	hsa-miR-3135	CLIP-seq
MIRT778873	hsa-miR-3174	CLIP-seq
MIRT778874	hsa-miR-3180-5p	CLIP-seq
MIRT778875	hsa-miR-3609	CLIP-seq
MIRT778876	hsa-miR-3613-3p	CLIP-seq
MIRT778877	hsa-miR-3622b-5p	CLIP-seq
MIRT778878	hsa-miR-3664-3p	CLIP-seq
MIRT778879	hsa-miR-3664-5p	CLIP-seq
MIRT778880	hsa-miR-3672	CLIP-seq
MIRT778881	hsa-miR-3689a-3p	CLIP-seq
MIRT778882	hsa-miR-3689c	CLIP-seq
MIRT778883	hsa-miR-3924	CLIP-seq
MIRT778884	hsa-miR-3929	CLIP-seq
MIRT778885	hsa-miR-3973	CLIP-seq
MIRT778886	hsa-miR-410	CLIP-seq
MIRT778887	hsa-miR-4419b	CLIP-seq
MIRT778888	hsa-miR-4433	CLIP-seq
MIRT778889	hsa-miR-4455	CLIP-seq
MIRT778890	hsa-miR-4459	CLIP-seq
MIRT778891	hsa-miR-4474-3p	CLIP-seq
MIRT778892	hsa-miR-4478	CLIP-seq
MIRT778893	hsa-miR-4517	CLIP-seq
MIRT778894	hsa-miR-4522	CLIP-seq
MIRT778895	hsa-miR-4635	CLIP-seq
MIRT778896	hsa-miR-4695-5p	CLIP-seq
MIRT778897	hsa-miR-4728-5p	CLIP-seq
MIRT778898	hsa-miR-4793-3p	CLIP-seq
MIRT778899	hsa-miR-485-5p	CLIP-seq
MIRT778900	hsa-miR-508-5p	CLIP-seq
MIRT778901	hsa-miR-510	CLIP-seq
MIRT778902	hsa-miR-512-5p	CLIP-seq
MIRT778903	hsa-miR-520g	CLIP-seq
MIRT778904	hsa-miR-520h	CLIP-seq
MIRT778905	hsa-miR-548ah	CLIP-seq
MIRT778906	hsa-miR-554	CLIP-seq
MIRT778907	hsa-miR-579	CLIP-seq
MIRT778908	hsa-miR-609	CLIP-seq
MIRT778909	hsa-miR-661	CLIP-seq
MIRT778910	hsa-miR-766	CLIP-seq
MIRT778911	hsa-miR-921	CLIP-seq
MIRT1920243	hsa-miR-3168	CLIP-seq
MIRT1920244	hsa-miR-587	CLIP-seq
MIRT1920243	hsa-miR-3168	CLIP-seq
MIRT1920244	hsa-miR-587	CLIP-seq
MIRT1920243	hsa-miR-3168	CLIP-seq
MIRT1920244	hsa-miR-587	CLIP-seq
MIRT1929924	hsa-miR-183	CLIP-seq
MIRT778869	hsa-miR-2114	CLIP-seq
MIRT778873	hsa-miR-3174	CLIP-seq
MIRT778877	hsa-miR-3622b-5p	CLIP-seq
MIRT778878	hsa-miR-3664-3p	CLIP-seq
MIRT778881	hsa-miR-3689a-3p	CLIP-seq
MIRT778882	hsa-miR-3689c	CLIP-seq
MIRT778884	hsa-miR-3929	CLIP-seq
MIRT778887	hsa-miR-4419b	CLIP-seq
MIRT778888	hsa-miR-4433	CLIP-seq
MIRT778890	hsa-miR-4459	CLIP-seq
MIRT778892	hsa-miR-4478	CLIP-seq
MIRT1929925	hsa-miR-4537	CLIP-seq
MIRT778896	hsa-miR-4695-5p	CLIP-seq
MIRT778897	hsa-miR-4728-5p	CLIP-seq
MIRT778898	hsa-miR-4793-3p	CLIP-seq
MIRT778899	hsa-miR-485-5p	CLIP-seq
MIRT778900	hsa-miR-508-5p	CLIP-seq
MIRT778901	hsa-miR-510	CLIP-seq
MIRT778902	hsa-miR-512-5p	CLIP-seq
MIRT778907	hsa-miR-579	CLIP-seq
MIRT778910	hsa-miR-766	CLIP-seq
MIRT778911	hsa-miR-921	CLIP-seq
MIRT1929924	hsa-miR-183	CLIP-seq
MIRT778869	hsa-miR-2114	CLIP-seq
MIRT778878	hsa-miR-3664-3p	CLIP-seq
MIRT778881	hsa-miR-3689a-3p	CLIP-seq
MIRT778882	hsa-miR-3689c	CLIP-seq
MIRT778884	hsa-miR-3929	CLIP-seq
MIRT778887	hsa-miR-4419b	CLIP-seq
MIRT778888	hsa-miR-4433	CLIP-seq
MIRT778889	hsa-miR-4455	CLIP-seq
MIRT778890	hsa-miR-4459	CLIP-seq
MIRT778892	hsa-miR-4478	CLIP-seq
MIRT778896	hsa-miR-4695-5p	CLIP-seq
MIRT778897	hsa-miR-4728-5p	CLIP-seq
MIRT778898	hsa-miR-4793-3p	CLIP-seq
MIRT778899	hsa-miR-485-5p	CLIP-seq
MIRT778900	hsa-miR-508-5p	CLIP-seq
MIRT778901	hsa-miR-510	CLIP-seq
MIRT778902	hsa-miR-512-5p	CLIP-seq
MIRT778907	hsa-miR-579	CLIP-seq
MIRT778908	hsa-miR-609	CLIP-seq
MIRT778909	hsa-miR-661	CLIP-seq
MIRT778910	hsa-miR-766	CLIP-seq
MIRT778869	hsa-miR-2114	CLIP-seq
MIRT778878	hsa-miR-3664-3p	CLIP-seq
MIRT778881	hsa-miR-3689a-3p	CLIP-seq
MIRT778882	hsa-miR-3689c	CLIP-seq
MIRT778884	hsa-miR-3929	CLIP-seq
MIRT778887	hsa-miR-4419b	CLIP-seq
MIRT778888	hsa-miR-4433	CLIP-seq
MIRT778890	hsa-miR-4459	CLIP-seq
MIRT778892	hsa-miR-4478	CLIP-seq
MIRT778896	hsa-miR-4695-5p	CLIP-seq
MIRT778897	hsa-miR-4728-5p	CLIP-seq
MIRT778899	hsa-miR-485-5p	CLIP-seq
MIRT778901	hsa-miR-510	CLIP-seq
MIRT778902	hsa-miR-512-5p	CLIP-seq
MIRT778907	hsa-miR-579	CLIP-seq
MIRT778878	hsa-miR-3664-3p	CLIP-seq
MIRT778881	hsa-miR-3689a-3p	CLIP-seq
MIRT778882	hsa-miR-3689c	CLIP-seq
MIRT778884	hsa-miR-3929	CLIP-seq
MIRT778887	hsa-miR-4419b	CLIP-seq
MIRT778888	hsa-miR-4433	CLIP-seq
MIRT778890	hsa-miR-4459	CLIP-seq
MIRT778892	hsa-miR-4478	CLIP-seq
MIRT778896	hsa-miR-4695-5p	CLIP-seq
MIRT778897	hsa-miR-4728-5p	CLIP-seq
MIRT778899	hsa-miR-485-5p	CLIP-seq
MIRT778901	hsa-miR-510	CLIP-seq
MIRT778902	hsa-miR-512-5p	CLIP-seq
MIRT778873	hsa-miR-3174	CLIP-seq
MIRT2473398	hsa-miR-4316	CLIP-seq
MIRT778911	hsa-miR-921	CLIP-seq
MIRT778869	hsa-miR-2114	CLIP-seq
MIRT778878	hsa-miR-3664-3p	CLIP-seq
MIRT778884	hsa-miR-3929	CLIP-seq
MIRT778887	hsa-miR-4419b	CLIP-seq
MIRT778888	hsa-miR-4433	CLIP-seq
MIRT778890	hsa-miR-4459	CLIP-seq
MIRT778892	hsa-miR-4478	CLIP-seq
MIRT778896	hsa-miR-4695-5p	CLIP-seq
MIRT778899	hsa-miR-485-5p	CLIP-seq
MIRT778901	hsa-miR-510	CLIP-seq
MIRT778902	hsa-miR-512-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CREBBP	Activation	12517954
EP300	Activation	12517954
HDAC1	Unknown	19198625
MTA1	Unknown	19198625
SPI1	Activation	16320347
STAT6	Activation	12517954
STAT6	Unknown	10657944

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001503	Process	Ossification	IEA
GO:0001503	Process	Ossification	ISS
GO:0002820	Process	Negative regulation of adaptive immune response	IEA
GO:0002820	Process	Negative regulation of adaptive immune response	ISS
GO:0004052	Function	Arachidonate 12(S)-lipoxygenase activity	IBA
GO:0004052	Function	Arachidonate 12(S)-lipoxygenase activity	IDA	1944593
GO:0004052	Function	Arachidonate 12(S)-lipoxygenase activity	IEA
GO:0005506	Function	Iron ion binding	IEA
GO:0005506	Function	Iron ion binding	ISS
GO:0005515	Function	Protein binding	IPI	21831839, 28514442, 33961781
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	IDA	17052953
GO:0005737	Component	Cytoplasm	IEA
GO:0005811	Component	Lipid droplet	IDA	19528634
GO:0005811	Component	Lipid droplet	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	17052953, 21831839
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0006629	Process	Lipid metabolic process	IDA	23242647, 25293588
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006646	Process	Phosphatidylethanolamine biosynthetic process	IEA
GO:0006646	Process	Phosphatidylethanolamine biosynthetic process	ISS
GO:0006954	Process	Inflammatory response	TAS	10200270
GO:0008289	Function	Lipid binding	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IDA	17052953
GO:0010811	Process	Positive regulation of cell-substrate adhesion	IDA	11278875
GO:0016020	Component	Membrane	IDA	21831839
GO:0016020	Component	Membrane	IEA
GO:0016165	Function	Linoleate 13S-lipoxygenase activity	IBA
GO:0016165	Function	Linoleate 13S-lipoxygenase activity	IDA	8334154
GO:0016165	Function	Linoleate 13S-lipoxygenase activity	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016702	Function	Oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	IEA
GO:0019369	Process	Arachidonate metabolic process	IBA
GO:0019369	Process	Arachidonate metabolic process	IDA	1944593, 8334154, 17052953, 24282679
GO:0019369	Process	Arachidonate metabolic process	IEA
GO:0019369	Process	Arachidonate metabolic process	NAS	3202857
GO:0019372	Process	Lipoxygenase pathway	IBA
GO:0019372	Process	Lipoxygenase pathway	IDA	1944593, 23242647
GO:0019372	Process	Lipoxygenase pathway	IEA
GO:0019372	Process	Lipoxygenase pathway	TAS
GO:0019395	Process	Fatty acid oxidation	ISS
GO:0030282	Process	Bone mineralization	IEA
GO:0030282	Process	Bone mineralization	ISS
GO:0030838	Process	Positive regulation of actin filament polymerization	IEA
GO:0030838	Process	Positive regulation of actin filament polymerization	ISS
GO:0034440	Process	Lipid oxidation	IBA
GO:0034440	Process	Lipid oxidation	IEA
GO:0034976	Process	Response to endoplasmic reticulum stress	IEA
GO:0034976	Process	Response to endoplasmic reticulum stress	ISS
GO:0035358	Process	Regulation of peroxisome proliferator activated receptor signaling pathway	IEA
GO:0035358	Process	Regulation of peroxisome proliferator activated receptor signaling pathway	ISS
GO:0035963	Process	Cellular response to interleukin-13	IMP	21831839
GO:0042060	Process	Wound healing	IEA
GO:0042060	Process	Wound healing	ISS
GO:0042759	Process	Long-chain fatty acid biosynthetic process	IEA
GO:0042759	Process	Long-chain fatty acid biosynthetic process	TAS
GO:0043277	Process	Apoptotic cell clearance	IEA
GO:0043277	Process	Apoptotic cell clearance	ISS
GO:0043651	Process	Linoleic acid metabolic process	IDA	8334154
GO:0043651	Process	Linoleic acid metabolic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050473	Function	Arachidonate 15-lipoxygenase activity	IBA
GO:0050473	Function	Arachidonate 15-lipoxygenase activity	IDA	1944593, 8334154, 17052953, 24282679
GO:0050473	Function	Arachidonate 15-lipoxygenase activity	IEA
GO:0050473	Function	Arachidonate 15-lipoxygenase activity	NAS	3202857
GO:0050473	Function	Arachidonate 15-lipoxygenase activity	TAS
GO:0050727	Process	Regulation of inflammatory response	IDA	23242647
GO:0051122	Process	Hepoxilin biosynthetic process	ISS
GO:0051213	Function	Dioxygenase activity	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	21831839
GO:0071277	Process	Cellular response to calcium ion	IDA	17052953
GO:1901074	Process	Regulation of engulfment of apoptotic cell	IEA
GO:1901074	Process	Regulation of engulfment of apoptotic cell	ISS
GO:2001303	Process	Lipoxin A4 biosynthetic process	IEA
GO:2001303	Process	Lipoxin A4 biosynthetic process	ISS

Other IDs

• MIM: 152392
• HGNC: 433
• e!Ensembl: ENSG00000161905

Protein

• UniProt ID: P16050
• Protein name: Polyunsaturated fatty acid lipoxygenase ALOX15 (12/15-lipoxygenase) (Arachidonate 12-lipoxygenase, leukocyte-type) (12-LOX) (EC 1.13.11.31) (Arachidonate 15-lipoxygenase) (15-LOX) (15-LOX-1) (EC 1.13.11.33) (Arachidonate omega-6 lipoxygenase) (Hepoxilin A
• Protein function: Non-heme iron-containing dioxygenase that catalyzes the stereo-specific peroxidation of free and esterified polyunsaturated fatty acids generating a spectrum of bioactive lipid mediators (PubMed:17052953, PubMed:1944593, PubMed:24282679, PubMed:
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01477	PLAT	4 → 107	PLAT/LH2 domain	Domain
  PF00305	Lipoxygenase	183 → 650	Lipoxygenase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in monocytes and eosinophils (at protein level). Expressed in airway epithelial cells. {ECO:0000269|PubMed:21831839, ECO:0000269|PubMed:9414270}.
• Sequence:

  MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPL
  LFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDP
  QGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAK
  GLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVV
  LRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPL
  VMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSH
  LLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMST
  GGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVS
  LHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQH
  ASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQ
  PVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSV
  AI

• Sequence length: 662

Pathways

KEGG:

Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Efferocytosis
Ferroptosis
Necroptosis
Serotonergic synapse

Reactome:

Synthesis of Leukotrienes (LT) and Eoxins (EX)
Synthesis of 12-eicosatetraenoic acid derivatives
Synthesis of 15-eicosatetraenoic acid derivatives
Interleukin-4 and Interleukin-13 signaling
Biosynthesis of DHA-derived SPMs
Biosynthesis of protectins
Biosynthesis of E-series 18(S)-resolvins
Biosynthesis of E-series 18(R)-resolvins
Biosynthesis of DPAn-6 SPMs
Biosynthesis of DPAn-3-derived protectins and resolvins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma, nasal polyps, and aspirin intolerance	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC RHINOSINUSITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE, DIASTOLIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASAL CAVITY POLYP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASAL POLYPS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL ALLERGIC RHINITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Cerebrovascular Accidents	Stroke	BEFREE	29079502		★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	25105362		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	11023533, 12664577		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	7624992		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	15912043		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	15912043, 16357157		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	15912043, 17236225		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	22960430		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	28827690		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	22094113		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	29891910		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	15111312, 16151530	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	29620941		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	24563424		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	27696115		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	27696115		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	15194425, 15576842, 15584868, 16270276, 16678271, 16919636, 17439326, 17869078, 17959182, 18000963, 18392641, 18559988, 19131063, 20676957, 21474962, 22351111, 22879973, 23589307, 28701173, 30300788, 30937959		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	17439326, 22573549, 23872401		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	17439326	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	28316377	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	15038835, 17439326, 19429775, 24465480, 30923181, 31095684, 32371071, 34106513, 38551536, 39270557	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	17439326, 17662651, 23528921, 31095684		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	18774388		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	11352986, 1729692, 17439326, 19429775, 19948975, 2010531, 28701173, 34905596, 7961680	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	15194425, 15576842, 15584868, 16270276, 16678271, 16919636, 17439326, 17869078, 17959182, 18000963, 18392641, 18559988, 19131063, 20676957, 21474962, 22351111, 22879973, 23589307, 28701173, 30300788, 30937959		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	CTD_human_DG	16303615		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	LHGDN	17439326, 18067895, 18392641		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Becker Muscular Dystrophy	Becker Muscular Dystrophy	BEFREE	17520163		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	15010818		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	18227726		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	24533104	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	27552229	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	27836541		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31663148, 9020925		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34059009, 37469520	Associate	★☆☆☆☆ Found in Text Mining only
Bronchitis Chronic	Bronchitis	Pubtator	11003605	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16357157, 18030360, 24634093	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17167069, 18198215, 19429775, 20570882, 30941737	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11406566, 15912043, 27836541		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35934785	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18785202, 20388757, 21881028		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21442472		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	30138423	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	16514435		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	27838820		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	27838820, 28057806, 29079502, 31562627		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	30410359		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	17043146		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	27836541		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	28492741	Associate	★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	30452122		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	30643255		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	GWASCAT_DG	30643255		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28089732, 29702245		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18388920, 24634093, 25713055		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	18799463		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11406566, 14566836, 15912043, 17151091, 18198215, 18785202, 19752603, 23715757, 25713055, 27320813, 28089732, 28757355, 31717983, 9927047		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12189136, 16179498, 16288226, 17167069, 18198215, 18785202, 18799463, 19198625, 20026301, 20570882, 21881028, 27320813, 27546520, 9705287	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15912043, 24634093	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16179498		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	9927047		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	30410359		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	19546247, 28506553, 30138423		★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	BEFREE	27825104		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	14654968, 15944770		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	17869078, 17959182, 20676957, 21558275, 29068244, 30282920		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	17439326, 17959182, 29068244, 34905596	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	17869078, 17959182, 19131063, 20676957, 21558275, 29068244, 30282920		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	17869078, 17959182, 20676957, 21558275, 29068244, 30282920		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	30643255		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	22985691		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	17918787, 28189826, 28694081, 31704449, 31704612		★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	25531160	Stimulate	★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	25531160	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	27825104, 29891910		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	30575130		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15576842, 16678271, 17943024, 23437231, 28351645, 28507520, 29468369, 30347209, 30659940		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15576842, 16678271, 17943024, 23437231, 28351645, 28507520, 29468369, 30347209, 30659940		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	24955608	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35634436	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	23437231, 28842399, 29095817		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20599608, 30347209		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	20599608		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	25562624, 25598081, 28351645, 29468369		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	LHGDN	12907138		★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia Anhidrotic with Immunodeficiency Osteopetrosis and Lymphedema	Anhidrotic ectodermal dysplasia with immunodeficiency, osteopetrosis, and lymphedema	Pubtator	23838566	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	30575130		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	18692814		★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	BEFREE	31275059		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	1662607	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	23503644, 37652141, 39343172	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	28812459, 28882697		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31231224		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	21442472		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	11406566		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	11406566		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	11406566		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophagitis	Esotropia	Pubtator	29628359	Associate	★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	29772700	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30855276, 31610178		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	37991252	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21596889		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	16675443	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	39913970	Inhibit	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	34758154	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	23535507, 26826164, 30138423	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	19546247, 28506553, 30138423		★☆☆☆☆ Found in Text Mining only
Heart Failure, Diastolic	Heart Failure	CTD_human_DG	29556499		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin Disease	Hodgkin Disease	BEFREE	22094113		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	23285160, 24465480	Associate	★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	33218117	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	25598081, 28351645		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	15081318, 29472381		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	22467300		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophy	Hypertrophy	Pubtator	29772700	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24634093	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27552229, 36316355	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30138423	Stimulate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	23285160	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	22275252, 27499089, 28720379		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28258529, 31275059		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	29891910		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	24955608	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	19046748, 22351111, 30602353, 31562627		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	19095947	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	17043146		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	17043146		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	37271497	Associate	★☆☆☆☆ Found in Text Mining only
Leukomalacia Periventricular	Periventricular leukomalacia	Pubtator	23838566	Associate	★☆☆☆☆ Found in Text Mining only
Leukostasis	Leukostasis	BEFREE	28351645		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	27836541, 31026746		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18785202, 8761486	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	20388757		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15194425		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31663148, 9020925		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	11406566		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	11406566		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20388757, 21881028		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	21442472		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	18030360		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12874035, 15010818, 20303950, 21596889, 23526143, 24061634, 27362790, 29940744, 7624992, 9321930		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20649594, 31371993		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	22864639		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12874035, 15519529, 17460548, 18388920, 18799463, 19752603, 21881028, 24634093, 25064129, 25105362, 28089732, 29940744, 30008824, 31288808, 31297564, 31314163, 31371993, 31663148		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18388920, 24634093, 25713055		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12907138, 16556493		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10667390, 15305153, 23664097		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	29992788		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	30941737		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	30941737	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30472260		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	16037976		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	26826164		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	23838566	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30282920		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	30292675		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	16598376	Inhibit	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	17043146, 25105362		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	17043146		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	19046748, 19131063, 31602241		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	27552229		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	27552229	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	30643255		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasal Polyps	Nasal polyposis	GWASCAT_DG	30643255		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasal Polyps	Nasal polyposis	CTD_human_DG	30643255		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasal Polyps	Nasal polyp	Pubtator	32371071, 33218117	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32986378	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10667390, 11406566, 14654968, 17018618, 18030360, 18198215, 20649594, 21596889, 23404351, 25064129, 25713055, 27320813, 29992788, 30062726, 31288808, 31371993, 9927047		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	7967345		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29627380		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12234979, 29235036		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28720379		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	21587068, 28886991		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26331820		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21094135, 22301860, 24955608	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24955608		★☆☆☆☆ Found in Text Mining only
Olmsted syndrome	Olmsted Syndrome	BEFREE	28024685		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	28316377, 31704612	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	LHGDN	15838625		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	21442472		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	18030360		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	18030360		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18030360	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	15584868		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	28492741	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	28492741	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	20599608		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	20599608		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	31288808	Stimulate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	26372769		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12874035, 15010818, 20303950, 21596889, 23526143, 24061634, 27362790, 29940744, 7624992, 9321930		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	15010818		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12189136, 17218785, 21225230, 23066085, 23285160, 24061634	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	15720809		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	19089921		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	24975552		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	19429775	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	23404351, 23715757		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	14654968, 15944770		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	32371071	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	21228311		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	30743046		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10332966, 17918787, 23872401		★☆☆☆☆ Found in Text Mining only
SCAPULOPERONEAL MYOPATHY, X-LINKED DOMINANT	Scapuloperoneal Myopathy, X-Linked	BEFREE	30735438		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	30921410	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31776202		★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	Pubtator	32371071	Associate	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	10667390, 15305153		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	9174106		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17460548, 31571988		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35634436	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20649594, 31371993		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	30602353		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	27552229	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	22864639		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	22864639		★☆☆☆☆ Found in Text Mining only
Vitelliform Macular Dystrophy	Vitelliform Macular Dystrophy	BEFREE	17520163		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	29145845		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	29145845		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	33690107	Associate	★☆☆☆☆ Found in Text Mining only