Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	245711
Gene name	Speedy/RINGO cell cycle regulator family member A
Gene symbol	SPDYA
Synonyms (NCBI Gene)	RINGO3RINGOASPDY1SPY1
Chromosome	2
Chromosome location	2p23.2

Show/Hide all (87)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018986	hsa-miR-335-5p	Microarray	18185580
MIRT2337546	hsa-miR-1245b-3p	CLIP-seq
MIRT2337547	hsa-miR-3145-5p	CLIP-seq
MIRT2337548	hsa-miR-508-5p	CLIP-seq
MIRT2460362	hsa-miR-299-5p	CLIP-seq
MIRT2460363	hsa-miR-3117-5p	CLIP-seq
MIRT2460364	hsa-miR-3121-3p	CLIP-seq
MIRT2460365	hsa-miR-3147	CLIP-seq
MIRT2460366	hsa-miR-3148	CLIP-seq
MIRT2460367	hsa-miR-3674	CLIP-seq
MIRT2460368	hsa-miR-3688-3p	CLIP-seq
MIRT2460369	hsa-miR-4259	CLIP-seq
MIRT2460370	hsa-miR-431	CLIP-seq
MIRT2460371	hsa-miR-4426	CLIP-seq
MIRT2460372	hsa-miR-4529-5p	CLIP-seq
MIRT2460373	hsa-miR-4635	CLIP-seq
MIRT2460374	hsa-miR-4640-5p	CLIP-seq
MIRT2460375	hsa-miR-4647	CLIP-seq
MIRT2460376	hsa-miR-4662b	CLIP-seq
MIRT2460377	hsa-miR-4698	CLIP-seq
MIRT2460378	hsa-miR-4699-5p	CLIP-seq
MIRT2460379	hsa-miR-4703-3p	CLIP-seq
MIRT2460380	hsa-miR-4709-3p	CLIP-seq
MIRT2460381	hsa-miR-4715-5p	CLIP-seq
MIRT2460382	hsa-miR-4726-5p	CLIP-seq
MIRT2460383	hsa-miR-489	CLIP-seq
MIRT2460384	hsa-miR-511	CLIP-seq
MIRT2460385	hsa-miR-514	CLIP-seq
MIRT2460386	hsa-miR-514b-3p	CLIP-seq
MIRT2460387	hsa-miR-569	CLIP-seq
MIRT2631069	hsa-miR-1256	CLIP-seq
MIRT2631070	hsa-miR-2115	CLIP-seq
MIRT2460363	hsa-miR-3117-5p	CLIP-seq
MIRT2460364	hsa-miR-3121-3p	CLIP-seq
MIRT2460366	hsa-miR-3148	CLIP-seq
MIRT2631071	hsa-miR-34b	CLIP-seq
MIRT2631072	hsa-miR-3647-3p	CLIP-seq
MIRT2460367	hsa-miR-3674	CLIP-seq
MIRT2460368	hsa-miR-3688-3p	CLIP-seq
MIRT2631073	hsa-miR-410	CLIP-seq
MIRT2460370	hsa-miR-431	CLIP-seq
MIRT2460371	hsa-miR-4426	CLIP-seq
MIRT2460373	hsa-miR-4635	CLIP-seq
MIRT2631074	hsa-miR-4642	CLIP-seq
MIRT2460375	hsa-miR-4647	CLIP-seq
MIRT2460376	hsa-miR-4662b	CLIP-seq
MIRT2460377	hsa-miR-4698	CLIP-seq
MIRT2460378	hsa-miR-4699-5p	CLIP-seq
MIRT2460379	hsa-miR-4703-3p	CLIP-seq
MIRT2460380	hsa-miR-4709-3p	CLIP-seq
MIRT2631075	hsa-miR-4775	CLIP-seq
MIRT2631076	hsa-miR-4789-5p	CLIP-seq
MIRT2460383	hsa-miR-489	CLIP-seq
MIRT2460384	hsa-miR-511	CLIP-seq
MIRT2460385	hsa-miR-514	CLIP-seq
MIRT2460386	hsa-miR-514b-3p	CLIP-seq
MIRT2631077	hsa-miR-516a-3p	CLIP-seq
MIRT2460387	hsa-miR-569	CLIP-seq
MIRT2631078	hsa-miR-587	CLIP-seq
MIRT2631079	hsa-miR-590-3p	CLIP-seq
MIRT2631069	hsa-miR-1256	CLIP-seq
MIRT2631070	hsa-miR-2115	CLIP-seq
MIRT2460363	hsa-miR-3117-5p	CLIP-seq
MIRT2460364	hsa-miR-3121-3p	CLIP-seq
MIRT2460366	hsa-miR-3148	CLIP-seq
MIRT2631071	hsa-miR-34b	CLIP-seq
MIRT2631072	hsa-miR-3647-3p	CLIP-seq
MIRT2460367	hsa-miR-3674	CLIP-seq
MIRT2460368	hsa-miR-3688-3p	CLIP-seq
MIRT2631073	hsa-miR-410	CLIP-seq
MIRT2460370	hsa-miR-431	CLIP-seq
MIRT2460371	hsa-miR-4426	CLIP-seq
MIRT2460373	hsa-miR-4635	CLIP-seq
MIRT2631074	hsa-miR-4642	CLIP-seq
MIRT2460375	hsa-miR-4647	CLIP-seq
MIRT2460376	hsa-miR-4662b	CLIP-seq
MIRT2460377	hsa-miR-4698	CLIP-seq
MIRT2460378	hsa-miR-4699-5p	CLIP-seq
MIRT2460379	hsa-miR-4703-3p	CLIP-seq
MIRT2460380	hsa-miR-4709-3p	CLIP-seq
MIRT2460383	hsa-miR-489	CLIP-seq
MIRT2460384	hsa-miR-511	CLIP-seq
MIRT2460385	hsa-miR-514	CLIP-seq
MIRT2460386	hsa-miR-514b-3p	CLIP-seq
MIRT2631077	hsa-miR-516a-3p	CLIP-seq
MIRT2460387	hsa-miR-569	CLIP-seq
MIRT2631078	hsa-miR-587	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IBA
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	11980914
GO:0000781	Component	Chromosome, telomeric region	IEA
GO:0001741	Component	XY body	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IDA	11980914
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0006974	Process	DNA damage response	IDA	12839962
GO:0006974	Process	DNA damage response	IEA
GO:0007140	Process	Male meiotic nuclear division	IEA
GO:0007140	Process	Male meiotic nuclear division	ISS
GO:0007283	Process	Spermatogenesis	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	11980914
GO:0016233	Process	Telomere capping	IEA
GO:0019901	Function	Protein kinase binding	IBA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	11980914, 12839962, 28666995
GO:0030295	Function	Protein kinase activator activity	IDA	28666995
GO:0030295	Function	Protein kinase activator activity	IEA
GO:0045860	Process	Positive regulation of protein kinase activity	IDA	28666995
GO:0048477	Process	Oogenesis	IEA
GO:0070197	Process	Meiotic attachment of telomere to nuclear envelope	IEA
GO:0070200	Process	Establishment of protein localization to telomere	IEA

MIM	HGNC	e!Ensembl
614029	30613	ENSG00000163806

Q5MJ70

Protein name

Speedy protein A (Rapid inducer of G2/M progression in oocytes A) (RINGO A) (hSpy/Ringo A) (Speedy-1) (Spy1)

Protein function

Regulates the G1/S phase transition of the cell cycle by binding and activating CDK1 and CDK2 (PubMed:12972555). Contributes to CDK2 activation without promoting CDK2 phosphorylation, by inducing a conformation change of the CDK2 T-loop that obs

PDB

5UQ1 , 5UQ2 , 5UQ3 , 7E34

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF11357	Spy1	69 → 199	Cell cycle regulatory protein	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in testis. Expressed at a low level in wide range of tissues including bone marrow, brain, heart, kidney, colon, liver, placenta, spleen, skeletal muscle, salivary gland, thyroid gland, thymus, trachea and uterus. Expr

Sequence

MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNTHNNNKSKRPK
GPCLVIQRQDMTAFFKLFDDDLIQDFLWMDCCCKIADKYLLAMTFVYFKRAKFTISEHTR
INFFIALYLANTVEEDEEETKYEIFPWALGKNWRKLFPNFLKLRDQLWDRIDYRAIVSRR
CCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRL
GLSSSSSLSSHTAGVTEKHSQDSYNSLSMDIIGDPSQAYTGSEVVNDHQSNKGKKTNFLK
KDKSMEWFTGSEE

Sequence length

313

Interactions

View interactions

	KEGG
	Oocyte meiosis Progesterone-mediated oocyte maturation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (19)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	30630676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	26017671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28577080, 31077613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22457049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26644004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30147372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	22198468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	26644004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26017671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22447439, 24434210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22457049, 31574533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28577080, 31077613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26644004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22447439, 28666995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	24037419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22198468		★★★★★ ★☆☆☆☆ Found in Text Mining only
NOONAN SYNDROME-LIKE DISORDER WITH LOOSE ANAGEN HAIR 2	Noonan-Like Syndrome With Loose Anagen Hair	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26644004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30176944		★★★★★ ★☆☆☆☆ Found in Text Mining only

SPDYA (speedy/RINGO cell cycle regulator family member A)