Gene Gene information from NCBI Gene database.
Entrez ID 24147
Gene name Four-jointed box kinase 1
Gene symbol FJX1
Synonyms (NCBI Gene)
-
Chromosome 11
Chromosome location 11p13
Summary The protein encoded by this gene is the human ortholog of mouse and Drosophila four-jointed gene product. The Drosophila protein is important for growth and differentiation of legs and wings, and for proper development of the eyes. The exact function of t
miRNA miRNA information provided by mirtarbase database.
340
miRTarBase ID miRNA Experiments Reference
MIRT040642 hsa-miR-92b-3p CLASH 23622248
MIRT266060 hsa-miR-548a-3p HITS-CLIP 23824327
MIRT266064 hsa-miR-548ar-3p HITS-CLIP 23824327
MIRT266066 hsa-miR-548az-3p HITS-CLIP 23824327
MIRT266061 hsa-miR-548e-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0005615 Component Extracellular space IEA
GO:0005615 Component Extracellular space TAS 10072791
GO:0007267 Process Cell-cell signaling IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
612206 17166 ENSG00000179431
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86VR8
Protein name Four-jointed box protein 1 (Four-jointed protein homolog)
Protein function Acts as an inhibitor of dendrite extension and branching.
Family and domains
Sequence
MGRRMRGAAATAGLWLLALGSLLALWGGLLPPRTELPASRPPEDRLPRRPARSGGPAPAP
RFPLPPPLAWDARGGSLKTFRALLTLAAGADGPPRQSRSEPRWHVSARQPRPEESAAVHG
GVFWSRGLEEQVPPGFSEAQAAAWLEAARGARMVALERGGCGRSSNRLARFADGTRACVR
YGINPEQIQGEALSYYLARLLGLQRHVPPLALARVEARGAQWAQVQEELRAAHWTEGSVV
SLTRWLPNLTDVVVPAPWRSEDGRLRPLRDAGGELANLSQAELVDLVQWTDLILFDYLTA
NFDRLVSNLFSLQWDPRVMQRATSNLHRGPGGALVFLDNEAGLVHGYRVAGMWDKYNEPL
LQSVCVFRERTARRVLELHRGQDAAARLLRLYRRHEPRFPELAALADPHAQLLQRRLDFL
AKHILHCKAKYGRRSGT
Sequence length 437
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BRAIN NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenoma of large intestine Colorectal adenoma BEFREE 23922772
★☆☆☆☆
Found in Text Mining only
Benign neoplasm of brain, unspecified Brain Neoplasms CTD_human_DG 27935819
★☆☆☆☆
Found in Text Mining only
Brain Neoplasms Brain Neoplasms CTD_human_DG 27935819
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Brain Tumor, Primary Brain Neoplasms CTD_human_DG 27935819
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 30193086 Associate
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 23922772
★☆☆☆☆
Found in Text Mining only
Cystic kidney Cystic Kidney Disease BEFREE 31038742
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Type 2 Diabetes mellitus, type 2 Pubtator 35271662 Associate
★☆☆☆☆
Found in Text Mining only
Dyslipidemias Dyslipidemias Pubtator 37582372 Associate
★☆☆☆☆
Found in Text Mining only
Endometriosis Endometriosis BEFREE 28673206
★☆☆☆☆
Found in Text Mining only