Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	24146
Gene name	Claudin 15
Gene symbol	CLDN15
Synonyms (NCBI Gene)	-
Chromosome	7
Chromosome location	7q22.1
Summary	This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellula

Show/Hide all (27)

miRTarBase ID	miRNA	Experiments
MIRT895131	hsa-miR-130a	CLIP-seq
MIRT895132	hsa-miR-130b	CLIP-seq
MIRT895133	hsa-miR-301a	CLIP-seq
MIRT895134	hsa-miR-301b	CLIP-seq
MIRT895135	hsa-miR-3666	CLIP-seq
MIRT895136	hsa-miR-4295	CLIP-seq
MIRT895137	hsa-miR-4462	CLIP-seq
MIRT895138	hsa-miR-454	CLIP-seq
MIRT895139	hsa-miR-4693-3p	CLIP-seq
MIRT895140	hsa-miR-4696	CLIP-seq
MIRT895141	hsa-miR-4712-3p	CLIP-seq
MIRT895142	hsa-miR-602	CLIP-seq
MIRT1965414	hsa-miR-1204	CLIP-seq
MIRT1965415	hsa-miR-1908	CLIP-seq
MIRT1965416	hsa-miR-3180	CLIP-seq
MIRT1965417	hsa-miR-3180-3p	CLIP-seq
MIRT1965418	hsa-miR-3196	CLIP-seq
MIRT1965419	hsa-miR-4489	CLIP-seq
MIRT1965420	hsa-miR-4508	CLIP-seq
MIRT1965421	hsa-miR-4743	CLIP-seq
MIRT1965422	hsa-miR-663	CLIP-seq
MIRT1965423	hsa-miR-744	CLIP-seq
MIRT2201380	hsa-miR-338-5p	CLIP-seq
MIRT2201381	hsa-miR-4477a	CLIP-seq
MIRT2201382	hsa-miR-4729	CLIP-seq
MIRT2201383	hsa-miR-586	CLIP-seq
MIRT2201384	hsa-miR-887	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005198	Function	Structural molecule activity	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005923	Component	Bicellular tight junction	IBA
GO:0005923	Component	Bicellular tight junction	IEA
GO:0005923	Component	Bicellular tight junction	ISS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0007155	Process	Cell adhesion	IBA
GO:0016020	Component	Membrane	IEA
GO:0016328	Component	Lateral plasma membrane	IEA
GO:0016338	Process	Calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules	ISS
GO:0042802	Function	Identical protein binding	ISS
GO:0070160	Component	Tight junction	IDA	31188544, 35650657
GO:0070160	Component	Tight junction	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0070830	Process	Bicellular tight junction assembly	IBA
GO:0160184	Process	Paracellular transport	IDA	31188544, 35650657, 36008380
GO:0160184	Process	Paracellular transport	IEA
GO:0160187	Function	Paracellular tight junction channel activity	IDA	31188544, 35650657, 36008380
GO:1903985	Process	Regulation of intestinal D-glucose absorption	IEA
GO:1903985	Process	Regulation of intestinal D-glucose absorption	ISS
GO:1904729	Process	Regulation of intestinal lipid absorption	IEA
GO:1904729	Process	Regulation of intestinal lipid absorption	ISS

MIM	HGNC	e!Ensembl
615778	2036	ENSG00000106404

P56746

Protein name

Claudin-15

Protein function

Forms paracellular channels: polymerizes in tight junction strands with cation- and water-selective channels through the strands, conveying epithelial permeability in a process known as paracellular tight junction permeability (PubMed:12055082,

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00822	PMP22_Claudin	3 → 179	PMP-22/EMP/MP20/Claudin family	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in colon (at protein level). {ECO:0000269|PubMed:12055082}.

Sequence

MSMAVETFGFFMATVGLLMLGVTLPNSYWRVSTVHGNVITTNTIFENLWFSCATDSLGVY
NCWEFPSMLALSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA
GALHILAGICGMVAISWYAFNITRDFFDPLYPGTKYELGPALYLGWSASLISILGGLCLC
SACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV

Sequence length

228

Interactions

View interactions

	KEGG
	Virion - Hepatitis viruses Cell adhesion molecules Tight junction Leukocyte transendothelial migration Pathogenic Escherichia coli infection Hepatitis C

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MESOTHELIOMA, MALIGNANT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (19)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25935651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	31209247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	27957319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33714203	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	31605016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	31605016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	31605016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	31605016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	27869798, 31605016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	31605016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	31605016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	31605016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	31605016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	27869798	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Latent autoimmune diabetes in adults	Pubtator	33391182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malabsorption Syndromes	Malabsorption syndrome	Pubtator	31605016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Mesothelioma of Peritoneum	Peritoneal mesothelioma	BEFREE	17062665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25935651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25935651		★★★★★ ★☆☆☆☆ Found in Text Mining only

CLDN15 (claudin 15)