Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	24144
Gene name	Tuftelin interacting protein 11
Gene symbol	TFIP11
Synonyms (NCBI Gene)	NTR1STIPSTIP-1Spp382TIP39bK445C9.6
Chromosome	22
Chromosome location	22q12.1
Summary	This gene encodes a protein component of the spliceosome that promotes the release of the lariat-intron during late-stage splicing through the recruitment of a pre-mRNA splicing factor called DEAH-box helicase 15. The encoded protein contains a G-patch do

Show/Hide all (74)

miRTarBase ID	miRNA	Experiments	Reference
MIRT570507	hsa-miR-548b-3p	PAR-CLIP	20371350
MIRT570506	hsa-miR-5705	PAR-CLIP	20371350
MIRT570505	hsa-miR-361-5p	PAR-CLIP	20371350
MIRT570504	hsa-miR-425-3p	PAR-CLIP	20371350
MIRT570502	hsa-miR-6771-5p	PAR-CLIP	20371350
MIRT570503	hsa-miR-30c-1-3p	PAR-CLIP	20371350
MIRT570501	hsa-miR-30c-2-3p	PAR-CLIP	20371350
MIRT570500	hsa-miR-6788-5p	PAR-CLIP	20371350
MIRT570498	hsa-miR-1273h-5p	PAR-CLIP	20371350
MIRT570499	hsa-miR-30b-3p	PAR-CLIP	20371350
MIRT570497	hsa-miR-3689a-3p	PAR-CLIP	20371350
MIRT570496	hsa-miR-3689b-3p	PAR-CLIP	20371350
MIRT570495	hsa-miR-3689c	PAR-CLIP	20371350
MIRT570493	hsa-miR-6779-5p	PAR-CLIP	20371350
MIRT570494	hsa-miR-6780a-5p	PAR-CLIP	20371350
MIRT570492	hsa-miR-374a-3p	PAR-CLIP	20371350
MIRT570491	hsa-miR-887-5p	PAR-CLIP	20371350
MIRT533843	hsa-miR-670-3p	PAR-CLIP	22012620
MIRT533842	hsa-miR-4494	PAR-CLIP	22012620
MIRT533841	hsa-miR-499b-5p	PAR-CLIP	22012620
MIRT533840	hsa-miR-513b-5p	PAR-CLIP	22012620
MIRT533839	hsa-miR-1238-3p	PAR-CLIP	22012620
MIRT444870	hsa-miR-3200-5p	PAR-CLIP	22100165
MIRT444868	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT444867	hsa-miR-183-3p	PAR-CLIP	22100165
MIRT444866	hsa-miR-4452	PAR-CLIP	22100165
MIRT444870	hsa-miR-3200-5p	PAR-CLIP	22100165
MIRT444868	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT444867	hsa-miR-183-3p	PAR-CLIP	22100165
MIRT444866	hsa-miR-4452	PAR-CLIP	22100165
MIRT439470	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439470	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT570507	hsa-miR-548b-3p	PAR-CLIP	20371350
MIRT570506	hsa-miR-5705	PAR-CLIP	20371350
MIRT570505	hsa-miR-361-5p	PAR-CLIP	20371350
MIRT570504	hsa-miR-425-3p	PAR-CLIP	20371350
MIRT570502	hsa-miR-6771-5p	PAR-CLIP	20371350
MIRT570503	hsa-miR-30c-1-3p	PAR-CLIP	20371350
MIRT570501	hsa-miR-30c-2-3p	PAR-CLIP	20371350
MIRT570500	hsa-miR-6788-5p	PAR-CLIP	20371350
MIRT570498	hsa-miR-1273h-5p	PAR-CLIP	20371350
MIRT570499	hsa-miR-30b-3p	PAR-CLIP	20371350
MIRT570497	hsa-miR-3689a-3p	PAR-CLIP	20371350
MIRT570496	hsa-miR-3689b-3p	PAR-CLIP	20371350
MIRT570495	hsa-miR-3689c	PAR-CLIP	20371350
MIRT570493	hsa-miR-6779-5p	PAR-CLIP	20371350
MIRT570494	hsa-miR-6780a-5p	PAR-CLIP	20371350
MIRT570492	hsa-miR-374a-3p	PAR-CLIP	20371350
MIRT570491	hsa-miR-887-5p	PAR-CLIP	20371350
MIRT533843	hsa-miR-670-3p	PAR-CLIP	22012620
MIRT533842	hsa-miR-4494	PAR-CLIP	22012620
MIRT533841	hsa-miR-499b-5p	PAR-CLIP	22012620
MIRT533840	hsa-miR-513b-5p	PAR-CLIP	22012620
MIRT533839	hsa-miR-1238-3p	PAR-CLIP	22012620
MIRT444870	hsa-miR-3200-5p	PAR-CLIP	22100165
MIRT444868	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT444867	hsa-miR-183-3p	PAR-CLIP	22100165
MIRT444866	hsa-miR-4452	PAR-CLIP	22100165
MIRT444870	hsa-miR-3200-5p	PAR-CLIP	22100165
MIRT444868	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT444867	hsa-miR-183-3p	PAR-CLIP	22100165
MIRT444866	hsa-miR-4452	PAR-CLIP	22100165
MIRT1420647	hsa-miR-101	CLIP-seq
MIRT1420648	hsa-miR-144	CLIP-seq
MIRT1420649	hsa-miR-3921	CLIP-seq
MIRT1420650	hsa-miR-4278	CLIP-seq
MIRT1420651	hsa-miR-452	CLIP-seq
MIRT1420652	hsa-miR-4653-5p	CLIP-seq
MIRT1420653	hsa-miR-4676-3p	CLIP-seq
MIRT1420654	hsa-miR-4688	CLIP-seq
MIRT1420655	hsa-miR-4699-3p	CLIP-seq
MIRT1420656	hsa-miR-582-5p	CLIP-seq
MIRT1420657	hsa-miR-593	CLIP-seq
MIRT1420658	hsa-miR-642a	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000390	Process	Spliceosomal complex disassembly	IBA
GO:0000390	Process	Spliceosomal complex disassembly	IEA
GO:0000390	Process	Spliceosomal complex disassembly	IMP	19103666
GO:0000398	Process	MRNA splicing, via spliceosome	IC	11991638
GO:0000781	Component	Chromosome, telomeric region	IDA	17389648
GO:0003676	Function	Nucleic acid binding	IEA
GO:0005515	Function	Protein binding	IPI	17043677, 17389648, 21516116, 24304693, 25416956, 25910212, 26638075, 26871637, 27107012, 29892012, 31413325, 31515488, 32296183, 33961781, 39251607
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005681	Component	Spliceosomal complex	IDA	11991638
GO:0005681	Component	Spliceosomal complex	IEA
GO:0005730	Component	Nucleolus	IDA	17389648
GO:0005737	Component	Cytoplasm	IEA
GO:0006396	Process	RNA processing	IC	11991638
GO:0006397	Process	MRNA processing	IEA
GO:0008380	Process	RNA splicing	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0031012	Component	Extracellular matrix	IEA
GO:0031214	Process	Biomineral tissue development	IEA
GO:0031333	Process	Negative regulation of protein-containing complex assembly	IDA	17389648
GO:0031848	Process	Protection from non-homologous end joining at telomere	IC	17389648
GO:0071008	Component	U2-type post-mRNA release spliceosomal complex	IBA
GO:0071008	Component	U2-type post-mRNA release spliceosomal complex	IDA	19103666
GO:0071013	Component	Catalytic step 2 spliceosome	IDA	11991638
GO:2001033	Process	Negative regulation of double-strand break repair via nonhomologous end joining	ISS	17389648

MIM	HGNC	e!Ensembl
612747	17165	ENSG00000100109

Q9UBB9

Protein name

Tuftelin-interacting protein 11 (Septin and tuftelin-interacting protein 1) (STIP-1)

Protein function

Involved in pre-mRNA splicing, specifically in spliceosome disassembly during late-stage splicing events. Intron turnover seems to proceed through reactions in two lariat-intron associated complexes termed Intron Large (IL) and Intron Small (IS)

PDB

8RO2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12457	TIP_N	16 → 113	Tuftelin interacting protein N terminal	Family
PF01585	G-patch	149 → 193	G-patch domain	Family
PF07842	GCFC	397 → 666	GC-rich sequence DNA-binding factor-like protein	Family

Sequence

MSLSHLYRDGEGRIDDDDDERENFEITDWDLQNEFNPNRQRHWQTKEEATYGVWAERDSD
DERPSFGGKRARDYSAPVNFISAGLKKGAAEEAELEDSDDEEKPVKQDDFPKDFGPRKLK
TGGNFKPSQKGFAGGTKSFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIE
AKQRKGKGAVGAYGSERTTQSMQDFPVVDSEEEAEEEFQKELSQWRKDPSGSKKKPKYSY
KTVEELKAKGRISKKLTAPQKELSQVKVIDMTGREQKVYYSYSQISHKHNVPDDGLPLQS
QQLPQSGKEAKAPGFALPELEHNLQLLIDLTEQEIIQNDRQLQYERDMVVNLFHELEKMT
EVLDHEERVISNLSKVLEMVEECERRMQPDCSNPLTLDECARIFETLQDKYYEEYRMSDR
VDLAVAIVYPLMKEYFKEWDPLKDCTYGTEIISKWKSLLENDQLLSHGGQDLSADAFHRL
IWEVWMPFVRNIVTQWQPRNCDPMVDFLDSWVHIIPVWILDNILDQLIFPKLQKEVENWN
PLTDTVPIHSWIHPWLPLMQARLEPLYSPIRSKLSSALQKWHPSDSSAKLILQPWKDVFT
PGSWEAFMVKNIVPKLGMCLGELVINPHQQHMDAFYWVIDWEGMISVSSLVGLLEKHFFP
KWLQVLCSWLSNSPNYEEITKWYLGWKSMFSDQVLAHPSVKDKFNEALDIMNRAVSSNVG
AYMQPGARENIAYLTHTERRKDFQYEAMQERREAENMAQRGIGVAASSVPMNFKDLIETK
AEEHNIVFMPVIGKRHEGKQLYTFGRIVIYIDRGVVFVQGEKTWVPTSLQSLIDMAK

Sequence length

837

Interactions

View interactions

	Reactome
			mRNA Splicing - Major Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (16)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cervical cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (29)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	27758712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	30886340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	30886340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10690540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	27076683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20663927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	23790503	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	24033157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	24033157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	21212273		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	27758712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29900041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	27758712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10690540, 28536844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31034212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25724188, 29794962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10690540, 26354852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10690540, 26354852, 31034212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26354852		★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	31034212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10690540, 28536844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28536844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	29889537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	28536844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	10690540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	27758712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31034212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	22283733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25724188, 29794962		★★★★★ ★☆☆☆☆ Found in Text Mining only

TFIP11 (tuftelin interacting protein 11)