Gene Gene information from NCBI Gene database.
Entrez ID 24140
Gene name FtsJ RNA 2'-O-methyltransferase 1
Gene symbol FTSJ1
Synonyms (NCBI Gene)
CDLIVJM23MRX44MRX9SPB1TRMT7XLID9
Chromosome X
Chromosome location Xp11.23
Summary This gene encodes a member of the methyltransferase superfamily. The encoded protein localizes to the nucleolus, binds to S-adenosylmethionine, and may be involved in the processing and modification of ribosomal RNA. Mutations in this gene are associated
SNPs SNP information provided by dbSNP.
5
SNP ID Visualize variation Clinical significance Consequence
rs143734567 A>G Conflicting-interpretations-of-pathogenicity Coding sequence variant, non coding transcript variant, synonymous variant
rs797044864 T>A Pathogenic Intron variant, missense variant, non coding transcript variant, coding sequence variant
rs1569474795 ->C Likely-pathogenic Coding sequence variant, non coding transcript variant, frameshift variant
rs1602048728 A>G Pathogenic Splice acceptor variant, intron variant
rs1602048836 C>T Pathogenic Coding sequence variant, non coding transcript variant, stop gained, intron variant
miRNA miRNA information provided by mirtarbase database.
52
miRTarBase ID miRNA Experiments Reference
MIRT022963 hsa-miR-124-3p Microarray 18668037
MIRT023951 hsa-miR-1-3p Proteomics 18668040
MIRT049665 hsa-miR-92a-3p CLASH 23622248
MIRT038539 hsa-miR-30c-1-3p CLASH 23622248
MIRT1005806 hsa-miR-1200 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
GO ID Ontology Definition Evidence Reference
GO:0001510 Process RNA methylation IEA
GO:0002128 Process TRNA nucleoside ribose methylation IEA
GO:0002128 Process TRNA nucleoside ribose methylation IMP 26310293
GO:0002130 Process Wobble position ribose methylation IDA 32558197
GO:0002181 Process Cytoplasmic translation IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300499 13254 ENSG00000068438
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UET6
Protein name tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase (EC 2.1.1.205) (2'-O-ribose RNA methyltransferase TRM7 homolog) (Protein ftsJ homolog 1)
Protein function Methylates the 2'-O-ribose of nucleotides at positions 32 and 34 of the tRNA anticodon loop of substrate tRNAs (PubMed:25404562, PubMed:26310293, PubMed:32198346, PubMed:32558197, PubMed:33771871, PubMed:36720500). Requisite for faithful cytopla
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01728 FtsJ 21 199 FtsJ-like methyltransferase Family
Tissue specificity TISSUE SPECIFICITY: Found in fetal brain, lung, liver and kidney (PubMed:15162322). Widely expressed in adult tissue; with high expression in heart and liver, lower expression in skeletal muscle, kidney, and pancreas and also lowly expressed in brain and
Sequence
MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCAAPGSWSQVLS
QKIGGQGSGHVVAVDLQAMAPLPGVVQIQGDITQLSTAKEIIQHFKGCPADLVVCDGAPD
VTGLHDVDEYMQAQLLLAALNIATHVLKPGGCFVAKIFRGRDVTLLYSQLQVFFSSVLCA
KPRSSRNSSIEAFAVCQGY
DPPEGFIPDLSKPLLDHSYDPDFNQLDGPTRIIVPFVTCGD
LSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRV
DTFPQPLAAPQCHTLLAPEMEDNEMSCSP
Sequence length 329
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    tRNA modification in the nucleus and cytosol
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
16
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Intellectual disability Pathogenic rs2061565957 RCV001260765
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual disability, X-linked 9 Pathogenic rs2519393316, rs1602048836, rs2519380502, rs1602048728, rs2061548936 RCV000011641
RCV000011642
RCV000011643
RCV000011644
RCV001251770
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Autism spectrum disorder Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
FTSJ1-related disorder Uncertain significance; Likely benign; Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
History of neurodevelopmental disorder Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
2-3 toe syndactyly Syndactyly Of The Toes HPO_DG
★☆☆☆☆
Found in Text Mining only
Attention deficit hyperactivity disorder Attention Deficit Hyperactivity Disorder HPO_DG
★☆☆☆☆
Found in Text Mining only
Autistic behavior Autism HPO_DG
★☆☆☆☆
Found in Text Mining only
Developmental Disabilities Developmental disability Pubtator 29631977 Associate
★☆☆☆☆
Found in Text Mining only
Epilepsy Epilepsy BEFREE 25425167
★☆☆☆☆
Found in Text Mining only
Facial paralysis Facial paralysis HPO_DG
★☆☆☆☆
Found in Text Mining only
Global developmental delay Developmental Delay HPO_DG
★☆☆☆☆
Found in Text Mining only
Gross motor development delay Developmental delay HPO_DG
★☆☆☆☆
Found in Text Mining only
Guillain-Barre Syndrome Guillain-Barre Syndrome BEFREE 14638773
★☆☆☆☆
Found in Text Mining only
Guillain-Barre Syndrome, Familial Guillain-Barre Syndrome BEFREE 14638773
★☆☆☆☆
Found in Text Mining only