ALOX5 (arachidonate 5-lipoxygenase)

Gene

• Entrez ID: 240
• Gene name: Arachidonate 5-lipoxygenase
• Gene symbol: ALOX5
• Synonyms (NCBI Gene): 5-LO, 5-LOX, 5LPG, LOG5
• Chromosome: 10
• Chromosome location: 10q11.21
• Summary: This gene encodes a member of the lipoxygenase gene family and plays a dual role in the synthesis of leukotrienes from arachidonic acid. The encoded protein, which is expressed specifically in bone marrow-derived cells, catalyzes the conversion of arachid

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT736469	hsa-miR-125a-3p	RNA-seq, Immunofluorescence	33205517
MIRT736470	hsa-let-7e-3p	RNA-seq, Immunofluorescence	33205517
MIRT736469	hsa-miR-125a-3p	RNA-seq, Immunofluorescence	33205517
MIRT778919	hsa-miR-186	CLIP-seq
MIRT778920	hsa-miR-3688-3p	CLIP-seq
MIRT778921	hsa-miR-3978	CLIP-seq
MIRT778922	hsa-miR-4694-3p	CLIP-seq
MIRT778923	hsa-miR-4699-5p	CLIP-seq
MIRT778924	hsa-miR-522	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
EGR1	Activation	9062372
EGR1	Repression	15517885
EGR1	Unknown	10436859
HDAC2	Activation	21883892
HDAC3	Activation	21883892
MBD1	Repression	19781662
MBD2	Unknown	19781662
MECP2	Unknown	19781662
NFKB1	Repression	15517885
RELA	Repression	15517885
SP1	Activation	19781662;9062372
SP1	Unknown	10436859;2251250
TP53	Unknown	17018618

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001676	Process	Long-chain fatty acid metabolic process	IEA
GO:0001937	Process	Negative regulation of endothelial cell proliferation	IEA
GO:0001937	Process	Negative regulation of endothelial cell proliferation	ISS
GO:0002232	Process	Leukocyte chemotaxis involved in inflammatory response	IMP	17114001
GO:0002523	Process	Leukocyte migration involved in inflammatory response	IEA
GO:0002523	Process	Leukocyte migration involved in inflammatory response	ISS
GO:0002540	Process	Leukotriene production involved in inflammatory response	IEA
GO:0004051	Function	Arachidonate 5-lipoxygenase activity	IBA
GO:0004051	Function	Arachidonate 5-lipoxygenase activity	IDA	8615788, 8631361, 19022417, 21233389, 22516296, 23246375, 24282679, 24893149
GO:0004051	Function	Arachidonate 5-lipoxygenase activity	IEA
GO:0004051	Function	Arachidonate 5-lipoxygenase activity	TAS	2829172
GO:0004052	Function	Arachidonate 12(S)-lipoxygenase activity	IEA
GO:0005506	Function	Iron ion binding	IDA	21233389
GO:0005506	Function	Iron ion binding	IEA
GO:0005515	Function	Protein binding	IPI	7929073, 11297527, 16924104, 19022417, 19233132, 24860872, 25416956, 25910212, 26210919, 31515488, 32296183, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	22664934
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IBA
GO:0005635	Component	Nuclear envelope	IDA	19233132
GO:0005635	Component	Nuclear envelope	IEA
GO:0005635	Component	Nuclear envelope	TAS
GO:0005641	Component	Nuclear envelope lumen	IDA	8245774
GO:0005641	Component	Nuclear envelope lumen	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	19233132
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006690	Process	Icosanoid metabolic process	IEA
GO:0006691	Process	Leukotriene metabolic process	IEA
GO:0006691	Process	Leukotriene metabolic process	TAS	3422434
GO:0006950	Process	Response to stress	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006959	Process	Humoral immune response	IEA
GO:0006959	Process	Humoral immune response	ISS
GO:0016020	Component	Membrane	IEA
GO:0016363	Component	Nuclear matrix	IDA	19233132
GO:0016363	Component	Nuclear matrix	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016491	Function	Oxidoreductase activity	TAS
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0016525	Process	Negative regulation of angiogenesis	ISS
GO:0016701	Function	Oxidoreductase activity, acting on single donors with incorporation of molecular oxygen	TAS
GO:0016702	Function	Oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019369	Process	Arachidonate metabolic process	IBA
GO:0019370	Process	Leukotriene biosynthetic process	IDA	21233389, 24893149
GO:0019370	Process	Leukotriene biosynthetic process	IEA
GO:0019370	Process	Leukotriene biosynthetic process	IEA
GO:0019372	Process	Lipoxygenase pathway	IBA
GO:0019372	Process	Lipoxygenase pathway	TAS
GO:0030501	Process	Positive regulation of bone mineralization	IEA
GO:0030501	Process	Positive regulation of bone mineralization	ISS
GO:0031965	Component	Nuclear membrane	IDA	8245774
GO:0031965	Component	Nuclear membrane	IEA
GO:0034440	Process	Lipid oxidation	IBA
GO:0034440	Process	Lipid oxidation	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0036336	Process	Dendritic cell migration	IEA
GO:0036336	Process	Dendritic cell migration	ISS
GO:0036403	Function	Arachidonate 8(S)-lipoxygenase activity	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042593	Process	Glucose homeostasis	ISS
GO:0042759	Process	Long-chain fatty acid biosynthetic process	TAS
GO:0045598	Process	Regulation of fat cell differentiation	IEA
GO:0045598	Process	Regulation of fat cell differentiation	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	19022417
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050727	Process	Regulation of inflammatory response	IMP	17114001
GO:0050728	Process	Negative regulation of inflammatory response	IDA	21206090
GO:0050796	Process	Regulation of insulin secretion	IEA
GO:0050796	Process	Regulation of insulin secretion	ISS
GO:0051213	Function	Dioxygenase activity	IEA
GO:0061044	Process	Negative regulation of vascular wound healing	IEA
GO:0061044	Process	Negative regulation of vascular wound healing	ISS
GO:0061045	Process	Negative regulation of wound healing	IEA
GO:0061045	Process	Negative regulation of wound healing	ISS
GO:0106014	Process	Regulation of inflammatory response to wounding	IEA
GO:0106014	Process	Regulation of inflammatory response to wounding	ISS
GO:1900015	Process	Regulation of cytokine production involved in inflammatory response	IEA
GO:1900015	Process	Regulation of cytokine production involved in inflammatory response	ISS
GO:1900407	Process	Regulation of cellular response to oxidative stress	IEA
GO:1900407	Process	Regulation of cellular response to oxidative stress	ISS
GO:1901753	Process	Leukotriene A4 biosynthetic process	IDA	24282679
GO:1901753	Process	Leukotriene A4 biosynthetic process	IEA
GO:1901753	Process	Leukotriene A4 biosynthetic process	IMP	31664810
GO:1903426	Process	Regulation of reactive oxygen species biosynthetic process	IMP	26210919
GO:1903573	Process	Negative regulation of response to endoplasmic reticulum stress	IEA
GO:1903573	Process	Negative regulation of response to endoplasmic reticulum stress	ISS
GO:1903671	Process	Negative regulation of sprouting angiogenesis	IEA
GO:1903671	Process	Negative regulation of sprouting angiogenesis	ISS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:1904999	Process	Positive regulation of leukocyte adhesion to arterial endothelial cell	IEA
GO:1904999	Process	Positive regulation of leukocyte adhesion to arterial endothelial cell	ISS
GO:2001301	Process	Lipoxin biosynthetic process	IMP	31664810
GO:2001301	Process	Lipoxin biosynthetic process	TAS

Other IDs

• MIM: 152390
• HGNC: 435
• e!Ensembl: ENSG00000012779

Protein

• UniProt ID: P09917
• Protein name: Polyunsaturated fatty acid 5-lipoxygenase (EC 1.13.11.-) (Arachidonate 5-lipoxygenase) (5-LO) (5-lipoxygenase) (EC 1.13.11.34)
• Protein function: Catalyzes the oxygenation of arachidonate ((5Z,8Z,11Z,14Z)-eicosatetraenoate) to 5-hydroperoxyeicosatetraenoate (5-HPETE) followed by the dehydration to 5,6- epoxyeicosatetraenoate (Leukotriene A4/LTA4), the first two steps in the biosynthesis o
• PDB: 3O8Y, 3V92, 3V98, 3V99, 6N2W, 6NCF, 7TTJ, 7TTK, 7TTL
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01477	PLAT	4 → 113	PLAT/LH2 domain	Domain
  PF00305	Lipoxygenase	216 → 662	Lipoxygenase	Domain

• Sequence:

  MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDE
  ELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLA
  RDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVL
  NYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNG
  CNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDP
  CTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDF
  HVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECG
  LFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWE
  AIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYL
  TVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCW
  HLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPY
  YYLSPDRIPNSVAI

• Sequence length: 674

Pathways

KEGG:

Arachidonic acid metabolism
Metabolic pathways
Efferocytosis
Fc epsilon RI signaling pathway
Serotonergic synapse
Ovarian steroidogenesis
Toxoplasmosis

Reactome:

Synthesis of 5-eicosatetraenoic acids
Synthesis of Leukotrienes (LT) and Eoxins (EX)
Synthesis of Lipoxins (LX)
Interleukin-4 and Interleukin-13 signaling
Neutrophil degranulation
Interleukin-18 signaling
Biosynthesis of D-series resolvins
Biosynthesis of maresins
Biosynthesis of E-series 18(S)-resolvins
Biosynthesis of aspirin-triggered D-series resolvins
Biosynthesis of E-series 18(R)-resolvins
Biosynthesis of DPAn-3-derived protectins and resolvins
Biosynthesis of DPAn-3-derived maresins
Biosynthesis of DPAn-3-derived 13-series resolvins
Biosynthesis of electrophilic ω-3 PUFA oxo-derivatives

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma, diminished response to antileukotriene treatment in	drug response; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis, susceptibility to	drug response; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast ductal adenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC POLYPS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION, PULMONARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of the head and neck	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR GERM CELL TUMOR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URTICARIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	18398223		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	8456058		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18976020		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	30258081		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	30258081		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	25483364		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	30258081		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	30258081		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	30258081		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	17277229, 29339153		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	CTD_human_DG	18927292		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	17236225		★☆☆☆☆ Found in Text Mining only
Adenoma, Basal Cell	Adenoma	CTD_human_DG	18927292		★☆☆☆☆ Found in Text Mining only
Adenoma, Microcystic	Adenoma	CTD_human_DG	18927292		★☆☆☆☆ Found in Text Mining only
Adenoma, Monomorphic	Adenoma	CTD_human_DG	18927292		★☆☆☆☆ Found in Text Mining only
Adenoma, Trabecular	Adenoma	CTD_human_DG	18927292		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	18927292		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	LHGDN	18927292		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	31300449		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	15301234		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	10769133		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	18525291, 27896923		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	17998412, 21435457, 22697885, 25802082		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	15379894		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	12454701		★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	18945963	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	11919546		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	15322539, 15823697, 17182931, 29483877		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	21078989	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	27927271, 31539405	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	21078989, 22129473, 25324573		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	22616993		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	22616993	Associate	★☆☆☆☆ Found in Text Mining only
Argininosuccinic Aciduria	Argininosuccinic aciduria	Pubtator	16361798	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	14501583, 14702425, 16210619, 16278051, 17373938, 17481551, 18179798, 18258817, 18421434, 18842779, 18991687, 19130089, 19754386, 20592751, 22726381, 25721704, 27025886, 30825235, 31316498		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis	Arthritis	BEFREE	20656922, 25229347, 27895169, 27904990		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	28316377, 38508862	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	BEFREE	28699354, 30247644, 30265377		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10369259, 11035107, 11471199, 12911785, 15784112, 16210619, 16361798, 16364163, 16825866, 18204779, 18665843, 19214143, 19665766, 20093252, 20128419, 20880396, 22409990, 23600541, 25483364, 26032638, 26298204, 27799535, 27904990, 28623130, 28647490, 28699354, 29133059, 29749828, 30199704, 30237488, 30352167, 30638966, 31655025, 31719880, 31785932, 9062372, 9642160, 9988463		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	11471199, 16293801, 16415251, 17153879, 18339529, 18583575, 19214143, 23600541, 24059322, 28623130, 30352167, 30678465, 32096311, 37567324, 9062372	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	14749922, 16361798, 17460547, 18204779		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	40650018	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma, Aspirin-Induced	Asthma	BEFREE	21429049		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	16462489		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	14749922		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	12552108, 14702425, 18842779, 31316498	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	14501583, 14702425, 16210619, 16278051, 17373938, 17481551, 18179798, 18258817, 18421434, 18842779, 18991687, 19130089, 19754386, 20592751, 22726381, 25721704, 27025886, 30825235, 31316498		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	CTD_human_DG	16698924		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	LHGDN	18842779		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	24021653		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	19134178		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	22471974		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	14532840		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30739549		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	25193960		★☆☆☆☆ Found in Text Mining only
Brain Edema	Brain edema	Pubtator	1357659	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	28860177		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	1357659, 16462489, 31390836		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	1357659, 19919819, 31390836	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15899809, 16364620, 18843019, 21643005, 29736687, 31203442		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18087590, 21643005, 31203442, 37965796	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33224971	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchitis Chronic	Bronchitis	Pubtator	11003605	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	27855198	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	2786719		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18030360, 19919819, 20549218, 28600709	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11238189, 25934092		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20173757, 20364155	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30739549		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32144299, 38090559	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37164914	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	30258081		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	30258081		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	18090132		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	36035223	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	11471199, 19130089, 27893808	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	15322539, 16640955, 18323512, 18421434, 19130089, 19239910, 19754386, 19776641, 20093252, 27893808		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	BEFREE	17115186		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	18842779, 23067353	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	18842779		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	29383971	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	25242267		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	29041000, 37567324	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	14770184, 15322539, 15640973, 15731479, 15811259, 15861005, 16127181, 16943719, 17521309, 18323512, 19417766, 23324273, 23746795, 24198186, 24368493, 24411318, 25010723, 26944113, 30313062		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas Cardiomyopathy	BEFREE	27993857		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	16364163		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	31300449		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	18507031	Stimulate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	26718397, 30410359		★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	30258081		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	32093765	Associate	★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	16531984		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30649890		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	27784744		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	9649470		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	CTD_human_DG	15821759		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	BEFREE	29702245		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	30258081		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15161935, 15308583, 16537708, 18927292, 21885812, 26707712, 26997150		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	20549218	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	12751768, 15308583		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	14569062, 18927292, 30258081		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	BEFREE	15823697		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	18976020	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	36849252	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Polyps	Colonic polyps	Pubtator	37756582	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10679282, 17072961, 23404351, 26707712, 26997150, 28786533, 29339153		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	17072961		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17072961		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17072961, 18976020, 35444656, 37144561, 37586118, 37654195, 39940328, 40082818	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23013454	Stimulate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	30410359		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15944770, 17616938		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	30258081		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	15861005, 17627106, 18296320, 18369664, 27025886, 30869888, 30929436		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	15861005, 17627106, 18296320, 18369664, 19596330, 21293878, 27025886, 29067980, 30869888, 30929436		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	18369664, 21293878, 23067353, 29067980	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	15861005, 17627106, 18296320, 18369664, 19361804, 20558833, 27025886, 30869888, 30929436		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	22319020		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	18366797		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	14656710, 16951496, 21187935	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	21187935		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	31375151		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	15498796, 25091567, 28189826, 28316377, 29708818, 30498758, 8750209		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29174741		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	11508440		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	15301234		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	36358993	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	32093765	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	19787205, 29579961		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	34417262	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24059322, 26378572, 29383971, 32093765	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29095817, 30242286		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	24059322, 26378572, 30521849		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37038746	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	29758943		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30168128		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	30168128	Associate	★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	BEFREE	21224059		★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	28005266		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	17961045		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	15661803		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	31287882		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	25483364		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	CTD_human_DG	18927292		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	12751769		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16462489, 24005813, 27824118, 31390836		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31390836	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	16462489, 24005813, 27824118, 31390836		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	19423540, 19919819, 31390836, 32484805	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	10337029, 8468935		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	10337029	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	10337029	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	28947611		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	21656078		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	24059322	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	37073135	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	20061081		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11325678, 9491904		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	11325678, 9491904		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	19361804		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	29254095		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	15322539		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	19361804		★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	11788406, 24906007	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	19787205, 30406296, 31167124		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24906007	Stimulate	★☆☆☆☆ Found in Text Mining only
Ichthyosis Bullosa of Siemens	Junctional epidermolysis bullosa	Pubtator	34859100	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	15301234		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31462075, 9445303		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	12234060		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	9445303		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	8468935		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	25171226	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	27671344		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	29132227		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	22222029		★☆☆☆☆ Found in Text Mining only
Infarction, Middle Cerebral Artery	Cerebral Infraction	CTD_human_DG	19309543		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	12234060		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	12234060		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	18180307	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	11508440		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	38007425	Associate	★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	31316498		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	15811259, 15861005, 16130105, 18323512, 18398440, 19046748, 19417766, 20357438, 21816595, 23079278, 24183033, 24485247, 24635928, 29041000		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	10337029	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30649890		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	16531984	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29355720		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	16531984		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	LHGDN	17616938		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	23211037, 25193960, 26329759	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	24130502, 28500307		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	24130502, 28500307		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	15756036		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20173757, 20364155, 21801152, 21833474, 22293202		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	9649470		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	20173757, 20364155, 22293202		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	24906007	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	9445303		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37073135	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37164914	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	19134178	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	19134178		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	29561824, 29579961		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	21656078		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	21224059		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15899809, 16364620, 18843019, 21643005, 29736687, 31203442		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	30168128		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	21833474		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	17691999, 29891111		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	17616938		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	15756036		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	18090132		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	30258081		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	16037546, 17369849, 18442195, 20860670, 21713446, 25483364, 28419443		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15305379, 16289380, 17695530, 20558833, 30728896		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	30258081		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	20061081		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30662635		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30739549		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11238189, 1357659, 15008988, 18927292, 19823023, 20497297, 21656078, 26887049, 26942689, 27016075, 27558792, 28125014, 28419443, 28566527, 28699354, 28720504, 28786533, 28803964, 29229677, 29679652, 29681851, 29891111, 30081353, 30229910, 30877972, 31316498, 31562745		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	14569062, 18927292, 30258081		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15161935, 15308583, 16537708, 18927292, 21885812, 26707712, 26997150		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12907138		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16185917, 16364620		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	21224059		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	29483877		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	31300449		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15132836		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	15132836	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	17961045		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29174741		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	30941737		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	30941737	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	32093765	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	29067980	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29067980		★☆☆☆☆ Found in Text Mining only
Middle Cerebral Artery Thrombosis	Cerebral Thrombosis	CTD_human_DG	19309543		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	28451886		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	14656710, 16531984	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	21720561		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	21720561	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	11730938		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	18366677	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	18366677	Stimulate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	12454701		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	CTD_human_DG	19503090, 19823023		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	19823023, 20470758, 21596859, 25193960, 28623130		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	27784744		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	14770184, 15811259, 15861005, 15886380, 16127181, 16943719, 17176247, 17304054, 17373938, 18179798, 18842779, 18991687, 19046748, 27849187, 27893808, 28566527, 29424356, 30678701		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	18842779, 23067353, 27893808, 30678701, 37567324	Associate	★☆☆☆☆ Found in Text Mining only
Myopathy Central Core	Central core myopathy	Pubtator	36035208	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	LHGDN	15301234		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	17141086		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	1357659, 17072961, 17369849, 17616938, 18030360, 18927292, 19003584, 20860670, 21713446, 22253131, 25483364, 27558792, 28125014, 28419443, 28500307, 29229677, 29736687, 31300449, 31374840		★☆☆☆☆ Found in Text Mining only
Nephrosclerosis	Nephrosclerosis	CTD_human_DG	30818366		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	10337029		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	10337029	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12629151, 28451886		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	24059322, 31316498	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	10877525, 24059322, 28530811		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	21587068, 29299197		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29901268		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	21587068, 26378572, 27207555		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24059322, 26378572	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37960823	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	1469057, 3164719	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	2174053, 3164719		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	18090132		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18421027		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	30258081		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20103664, 22282663	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	16037546, 18442195, 20860670, 21713446, 25483364, 28419443		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	CTD_human_DG	30258081		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	12163367		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	21713446		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	12163367, 20860670	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis, Acute Necrotizing	Necrotizing pancreatitis	BEFREE	29421656		★☆☆☆☆ Found in Text Mining only
Papillary adenoma	Papillary Adenoma	CTD_human_DG	18927292		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	30258081		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	22253131		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29561824, 29579961		★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	29125911		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	28569991, 28871891, 29381190		★☆☆☆☆ Found in Text Mining only
Polyarthritis	Polyarthritis	BEFREE	31827550		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	30649890		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	27784744		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	15301234		★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	16537708		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	7646998		★☆☆☆☆ Found in Text Mining only
Primary Progressive Aphasia (disorder)	Aphasia	BEFREE	30284229		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15305379, 16289380, 17695530, 20558833, 30728896		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12859962, 15010818		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15305379, 17218785, 21824498, 23076676, 25540201, 25875826, 9789062	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	30258081		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Refractory anemias	Anemia	BEFREE	21352343		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	17616938		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15944770, 17616938		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	30258081		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	30649890		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	10337029		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	19665766		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	19665766		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	21307302		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	12833524		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19497113, 21352343, 25229347, 28316377, 8750209		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma Kaposi	Sarcoma	Pubtator	24335295	Associate	★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	30258081		★☆☆☆☆ Found in Text Mining only
SCAPULOPERONEAL MYOPATHY, X-LINKED DOMINANT	Scapuloperoneal Myopathy, X-Linked	BEFREE	30735438		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	21352343		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	11508440	Associate	★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	28238167		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	11508440		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	22761257		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29805660		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	21656078		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Steatohepatitis	Fatty Liver	BEFREE	31287882		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30662635		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	20061081		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	34121352	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	BEFREE	11508440, 21352343		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	31375151		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	25122659, 25802082, 29106033, 29128902, 29249809, 29607621, 29758943		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	CTD_human_DG	30258081		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Testicular Neoplasms	Testicular Neoplasms	LHGDN	14767568		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	22253131, 39510033	Associate	★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	29736687		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35664354, 38062004	Associate	★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	16361798, 26959713		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urticaria	Urticaria	LHGDN	16361798		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urticaria	Urticaria	Pubtator	16361798	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urticaria	Urticaria	CTD_human_DG	16502481		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Dysplasia	Uterine disease	Pubtator	20549218	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33786614, 39224598	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	9445303		★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	8879231	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	33690107	Associate	★☆☆☆☆ Found in Text Mining only
Xanthoma	Xanthoma	BEFREE	19361804		★☆☆☆☆ Found in Text Mining only