ALK (ALK receptor tyrosine kinase)

Gene

• Entrez ID: 238
• Gene name: ALK receptor tyrosine kinase
• Gene symbol: ALK
• Synonyms (NCBI Gene): ALK1, CD246, NBLST3
• Chromosome: 2
• Chromosome location: 2p23.2-p23.1
• Summary: This gene encodes a receptor tyrosine kinase, which belongs to the insulin receptor superfamily. This protein comprises an extracellular domain, an hydrophobic stretch corresponding to a single pass transmembrane region, and an intracellular kinase domain

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs76150405	G>A	Conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, synonymous variant, genic downstream transcript variant
rs113994087	C>A,T	Likely-pathogenic, pathogenic, risk-factor	Missense variant, coding sequence variant, genic downstream transcript variant
rs113994088	C>G	Likely-pathogenic, pathogenic, risk-factor	Missense variant, coding sequence variant, genic downstream transcript variant
rs113994089	C>G,T	Likely-pathogenic, uncertain-significance, pathogenic, risk-factor	Missense variant, coding sequence variant, genic downstream transcript variant
rs113994091	G>A,C	Uncertain-significance, pathogenic, risk-factor	Missense variant, coding sequence variant, genic downstream transcript variant
rs113994092	A>G	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs145028315	G>A,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, genic downstream transcript variant, stop gained, synonymous variant
rs201768549	C>A,G,T	Uncertain-significance, conflicting-interpretations-of-pathogenicity, not-provided	Coding sequence variant, genic downstream transcript variant, missense variant
rs281864719	A>C,G,T	Likely-pathogenic, pathogenic	Coding sequence variant, genic downstream transcript variant, missense variant
rs281864720	A>C,G,T	Likely-pathogenic, pathogenic	Coding sequence variant, genic downstream transcript variant, missense variant
rs370170353	G>A,C	Conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, missense variant, synonymous variant, genic downstream transcript variant, downstream transcript variant
rs863225281	G>C,T	Likely-pathogenic, not-provided, pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs863225282	A>C	Likely-pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs863225283	A>C	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs863225284	G>C,T	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs863225285	T>G	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs864309584	C>T	Pathogenic, uncertain-significance	Coding sequence variant, downstream transcript variant, missense variant, genic downstream transcript variant
rs1057519696	C>T	Pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs1057519697	A>C	Pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs1057519698	A>G,T	Pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs1057519781	C>G	Not-provided, likely-pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs1057519782	G>T	Not-provided, likely-pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs1057519783	C>T	Not-provided, likely-pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs1057519784	G>T	Not-provided, likely-pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs1057519785	A>C	Not-provided, likely-pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs1057520019	A>C,G	Likely-pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021811	hsa-miR-132-3p	Microarray	17612493
MIRT053181	hsa-miR-96-5p	Luciferase reporter assay, qRT-PCR, Western blot	22414602

Transcription factors

Transcription factor	Regulation	Reference
PHOX2B	Activation	20957039

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IDA	9174053
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	TAS
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IBA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IDA	9174053, 30061385, 34646012
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	TAS	19459784
GO:0005515	Function	Protein binding	IPI	17681947, 22939624, 26418745, 35384245
GO:0005524	Function	ATP binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	34646012, 34819673
GO:0005886	Component	Plasma membrane	IDA	9174053
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	19459784
GO:0006950	Process	Response to stress	IEA
GO:0007165	Process	Signal transduction	TAS	19459784
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IDA	30061385, 34646012, 34819673
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IDA	25605972, 30061385, 34646012
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007420	Process	Brain development	IEA
GO:0008201	Function	Heparin binding	IDA	25605972, 34646012
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016310	Process	Phosphorylation	IDA	9174053
GO:0016740	Function	Transferase activity	IEA
GO:0021766	Process	Hippocampus development	IEA
GO:0030298	Function	Receptor signaling protein tyrosine kinase activator activity	IDA	30061385, 34646012
GO:0030298	Function	Receptor signaling protein tyrosine kinase activator activity	IEA
GO:0030534	Process	Adult behavior	IEA
GO:0032991	Component	Protein-containing complex	IDA	23382219
GO:0036269	Process	Swimming behavior	IEA
GO:0038083	Process	Peptidyl-tyrosine autophosphorylation	IDA	30061385, 34646012
GO:0042127	Process	Regulation of cell population proliferation	IBA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042802	Function	Identical protein binding	IPI	25517749
GO:0042981	Process	Regulation of apoptotic process	TAS	19459784
GO:0043235	Component	Receptor complex	IBA
GO:0045664	Process	Regulation of neuron differentiation	IBA
GO:0046777	Process	Protein autophosphorylation	IDA	9174053
GO:0046777	Process	Protein autophosphorylation	IDA	9174053
GO:0046777	Process	Protein autophosphorylation	TAS	19459784
GO:0048666	Process	Neuron development	TAS	19459784
GO:0050995	Process	Negative regulation of lipid catabolic process	IEA
GO:0050995	Process	Negative regulation of lipid catabolic process	ISS
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	TAS	19459784
GO:0060159	Process	Regulation of dopamine receptor signaling pathway	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0080090	Process	Regulation of primary metabolic process	IEA
GO:0090648	Process	Response to environmental enrichment	IEA
GO:0097009	Process	Energy homeostasis	IEA
GO:0097009	Process	Energy homeostasis	ISS
GO:1900006	Process	Positive regulation of dendrite development	IEA
GO:1900006	Process	Positive regulation of dendrite development	ISS

Other IDs

• MIM: 105590
• HGNC: 427
• e!Ensembl: ENSG00000171094

Protein

• UniProt ID: Q9UM73
• Protein name: ALK tyrosine kinase receptor (EC 2.7.10.1) (Anaplastic lymphoma kinase) (CD antigen CD246)
• Protein function: Neuronal receptor tyrosine kinase that is essentially and transiently expressed in specific regions of the central and peripheral nervous systems and plays an important role in the genesis and differentiation of the nervous system (PubMed:111214
• PDB: 2KUP, 2KUQ, 2XB7, 2XBA, 2XP2, 2YFX, 2YHV, 2YJR, 2YJS, 2YS5, 2YT2, 3AOX, 3L9P, 3LCS, 3LCT, 4ANL, 4ANQ, 4ANS, 4CCB, 4CCU, 4CD0, 4CLI, 4CLJ, 4CMO, 4CMT, 4CMU, 4CNH, 4CTB, 4CTC, 4DCE, 4FNW, 4FNX, 4FNY, 4FNZ, 4FOB, 4FOC, 4FOD, 4JOA, 4MKC, 4TT7, 4Z55, 5A9U, 5AA8, 5AA9, 5AAA, 5AAB, 5AAC, 5FTO, 5FTQ, 5IMX, 5IUG
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00629	MAM	266 → 426	MAM domain, meprin/A5/mu	Domain
  PF00629	MAM	480 → 635	MAM domain, meprin/A5/mu	Domain
  PF12810	Gly_rich	726 → 987		Family
  PF07714	PK_Tyr_Ser-Thr	1116 → 1383	Protein tyrosine and serine/threonine kinase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain and CNS. Also expressed in the small intestine and testis, but not in normal lymphoid cells. {ECO:0000269|PubMed:9174053}.
• Sequence:

  MGAIGLLWLLPLLLSTAAVGSGMGTGQRAGSPAAGPPLQPREPLSYSRLQRKSLAVDFVV
  PSLFRVYARDLLLPPSSSELKAGRPEARGSLALDCAPLLRLLGPAPGVSWTAGSPAPAEA
  RTLSRVLKGGSVRKLRRAKQLVLELGEEAILEGCVGPPGEAAVGLLQFNLSELFSWWIRQ
  GEGRLRIRLMPEKKASEVGREGRLSAAIRASQPRLLFQIFGTGHSSLESPTNMPSPSPDY
  FTWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRIPSEEASQ
  MDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVSVHRHLQPSGR
  YIAQLLPHNEAAREILLMPTPGKHGWTVLQGRIGRPDNPFRVALEYISSGNRSLSAVDFF
  ALKNCSEGTSPGSKMALQSSFTCWNGTVLQLGQACDFHQDCAQGEDESQMCRKLPVGFYC
  NFEDGFCGWTQGTLSPHTPQWQVRTLKDARFQDHQDHALLLSTTDVPASESATVTSATFP
  APIKSSPCELRMSWLIRGVLRGNVSLVLVENKTGKEQGRMVWHVAAYEGLSLWQWMVLPL
  LDVSDRFWLQMVAWWGQGSRAIVAFDNISISLDCYLTISGEDKILQNTAPKSRNLFERNP
  NKELKPGENSPRQTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVEVGSEGPL
  KGIQIWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKDDMLYILVGQQGE
  DACPSTNQLIQKVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPVPLII
  AAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLQEGA
  TGGHSCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMDGEDGVSFIS
  PLGILYTPALKVMEGHGEVNIKHYLNCSHCEVDECHMDPESHKVICFCDHGTVLAEDGVS
  CIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKL
  SKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPN
  DPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMA
  GGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCP
  GPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLW
  EIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIIL
  ERIEYCTQDPDVINTALPIEYGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREEERSPAA
  PPPLPTTSSGKAAKKPTAAEISVRVPRGPAVEGGHVNMAFSQSNPPSELHKVHGSRNKPT
  SLWNPTYGSWFTEKPTKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRLPGASLLLEPS
  SLTANMKEVPLFRLRHFPCGNVNYGYQQQGLPLEAATAPGAGHYEDTILKSKNSMNQPGP
  

• Sequence length: 1620

Pathways

KEGG:

Pathways in cancer
Non-small cell lung cancer
PD-L1 expression and PD-1 checkpoint pathway in cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
ALK-related disorder	Likely pathogenic	rs1057519697	RCV003401411	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hereditary cancer-predisposing syndrome	Pathogenic	rs113994087	RCV002354167	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Lung cancer	Likely pathogenic	rs2148166660, rs1057519784	RCV002283356 RCV002282133	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neoplasm	Pathogenic	rs281864719	RCV006273629	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neuroblastoma	Pathogenic; Likely pathogenic	rs863225283, rs281864720, rs863225281, rs281864719, rs113994087, rs113994088, rs1057519697, rs1057519698	RCV006253887 RCV006253886 RCV006253885 RCV006253884 RCV006253671 RCV006253672 RCV006253948 RCV000656371	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Neuroblastoma, susceptibility to, 3	Pathogenic; Likely pathogenic	rs863225285, rs863225284, rs863225283, rs281864720, rs863225282, rs863225281, rs281864719, rs113994087, rs113994088, rs113994089	RCV000201889 RCV000201908 RCV000201887 RCV000201924 RCV000201906 RCV000201904 RCV000201882 RCV000201883 RCV000201918 RCV000019709 RCV000019710 RCV000019711 RCV000055894	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Ovarian cancer	Likely pathogenic	rs2148443351	RCV003154811	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Rhabdomyosarcoma	Likely pathogenic	rs1668950344	RCV001257557	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET'S SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONOTRUNCAL HEART MALFORMATIONS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC MACULOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFERENTIATED THYROID CARCINOMA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diffuse midline glioma, H3 K27-altered	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diffuse pediatric-type high-grade glioma, H3-wildtype and IDH-wildtype	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial isolated pituitary adenoma	Uncertain significance; Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
GASTRIC CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC ULCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung adenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA, LARGE B-CELL, DIFFUSE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign; Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple endocrine neoplasia type 2A	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma Susceptibility	Benign; Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance; Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Phonic tics	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pseudo-fractures	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell lung carcinoma	Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abetalipoproteinemia	Abetalipoproteinemia	BEFREE	17392503		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	25695223		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	11488062		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	16127683		★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	24613277		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	22845480		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	18166835, 18320074, 18594010, 19170230, 19386350, 20009909, 20031962, 20130484, 20183914, 20624322, 20659620, 20926401, 20979469, 21036415, 21233671, 21358343, 21562939, 21823889, 21844131, 21855164, 22071784, 22129856, 22153831, 22323876, 22327623, 22494566, 22506598, 22569898, 22664824, 22706607, 22707299, 22912349, 23103072, 23108025, 23181703, 23341890, 23379755, 23423768, 23453647, 23490651, 23551194, 23552377, 23562183, 23617234, 23625156, 23731739, 23741400, 23743928, 23743932, 23801495, 23891509, 23891510, 23936355, 23955278, 24128715, 24183104, 24194854, 24221342, 24300132, 24342286, 24346090, 24357739, 24361161, 24404167, 24518094, 24612196, 24736082, 24775606, 24885886, 24959902, 24982390, 25153496, 25238939, 25312989, 25360721, 25381900, 25434695, 25557162, 25575117, 25582278, 25588859, 25695224, 25706305, 25839699, 26076736, 26294238, 26416997, 26422230, 26603857, 26646246, 26752677, 26789109, 26898615, 27114375, 27142166, 27237034, 27352172, 27381270, 27461700, 27500967, 27562706, 27573752, 27756333, 27879019, 27892978, 27943404, 27987586, 28104537, 28189201, 28237660, 28285687, 28316074, 28364271, 28423587, 28507793, 28516197, 28529640, 28811082, 28834601, 28840016, 29173772, 29310482, 29517858, 29530732, 29538329, 29610932, 29629521, 29637735, 29714122, 29737033, 29883837, 30194036, 30218431, 30591488, 30642554, 30790327, 30840206, 30854949, 30900377, 30959466, 31093306, 31138506, 31410065, 31494736, 31588629, 31737311		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18923524		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	24992173, 26172300, 26933125		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	18923524, 19234440, 19383809, 19749796, 20179225, 20624322, 20659620, 20855837, 21036415, 21107285, 21129606, 21160078, 21656749, 21847362, 21855164, 21921848, 22071784, 22080568, 22100693, 22124476, 22129856, 22135231, 22266863, 22296236, 22327622, 22483782, 22605530, 22707299, 22743652, 22999080, 23098378, 23131393, 23150706, 23289484, 23325296, 23392229, 23407557, 23408463, 23489560, 23523007, 23536384, 23617234, 23617826, 23625156, 23661334, 23661716, 23664446, 23715289, 23743928, 23775406, 23787064, 23788756, 23802852, 23887300, 23904459, 23922677, 23988776, 23991695, 24075124, 24194854, 24296758, 24327273, 24346090, 24360397, 24361161, 24380695, 24422905, 24442099, 24477503, 24490615, 24508692, 24518094, 24643262, 24667320, 24727987, 24736082, 24775606, 24809777, 24842379, 24885886, 24899136, 24935562, 24959902, 24992725, 25099128, 25122422, 25198510, 25243942, 25255293, 25273224, 25312988, 25312989, 25344360, 25436805, 25467930, 25514802, 25527865, 25557162, 25575117, 25577516, 25581823, 25588859, 25596245, 25682546, 25695223, 25715771, 25789835, 25839699, 25855381, 25929957, 25982012, 26045865, 26130140, 26142544, 26301689, 26381283, 26391021, 26416997, 26422230, 26437441, 26469915, 26505450, 26599807, 26603857, 26620497, 26646246, 26654768, 26672084, 26703797, 26752677, 26762747, 26775590, 26791794, 26845116, 26880345, 26916631, 26933125, 26973202, 26990744, 27040850, 27078848, 27142166, 27343444, 27430882, 27460205, 27461706, 27467545, 27480287, 27496196, 27500967, 27507192, 27518729, 27552093, 27562706, 27565907, 27565908, 27573753, 27613526, 27615396, 27742540, 27756333, 27769042, 27776643, 27779369, 27864450, 27870944, 27943404, 28035073, 28104537, 28118634, 28128193, 28176910, 28199742, 28231386, 28280984, 28362192, 28364271, 28438234, 28570035, 28675026, 28677170, 28683775, 28705139, 28720066, 28740693, 28744138, 28838404, 28872581, 28887531, 28979143, 29123416, 29156778, 29207989, 29219616, 29251734, 29251824, 29268402, 29268403, 29290262, 29327716, 29487011, 29517858, 29541558, 29580750, 29629521, 29637735, 29656760, 29762727, 29781772, 30010043, 30069341, 30095461, 30144282, 30218431, 30255938, 30326973, 30327151, 30334450, 30476928, 30499220, 30504104, 30508887, 30573982, 30591488, 30658414, 30658713, 30662526, 30673691, 30741488, 30786826, 30788907, 30797488, 30885334, 30909092, 30959466, 31093306, 31123682, 31138506, 31215177, 31387567, 31455365, 31521978, 31538403, 31562206, 31596139, 31609765, 31613427, 31651223, 31699471, 31701509, 31737311, 31766077		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	20979469, 21823889, 22071784, 22135231, 22153831, 22743652, 22980554, 22999080		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CLINVAR_DG	22277784, 24327273, 24670165		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	28923119		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	12763927, 14576483, 15492998, 17277765, 17509395, 18220322, 18755494, 19521280, 19636007, 19734424, 22808292, 23457005, 24717232, 27740969, 28551388		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	16140928, 19531656, 24043362, 29024210		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	22810114, 27179218, 28338501, 30523493		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	19965671, 30082570		★☆☆☆☆ Found in Text Mining only
ALK positive large B-cell lymphoma	B-cell Lymphoma	BEFREE	21134980, 21497367, 23588372, 27686567, 27740969, 28665943		★☆☆☆☆ Found in Text Mining only
ALK positive large B-cell lymphoma	B-cell Lymphoma	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
ALK-positive anaplastic large cell lymphoma	Anaplastic Lymphoma	Orphanet			★☆☆☆☆ Found in Text Mining only
ALK-positive large B-cell lymphoma	B-cell Lymphoma	Orphanet			★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	28844318		★☆☆☆☆ Found in Text Mining only
ALPHA-THALASSEMIA/MENTAL RETARDATION SYNDROME, NONDELETION TYPE, X-LINKED	alpha-Thalassemia Mental Retardation Syndrome, X-Linked	BEFREE	23329364		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	29081033, 29567632		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	22810114, 26880345, 28351340, 30125543, 31539879		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	BEFREE	25501013		★☆☆☆☆ Found in Text Mining only
Anaplastic Large Cell Lymphoma, ALK-Positive	Anaplastic Lymphoma	BEFREE	10552961, 10994999, 12181047, 16709933, 16955462, 17464320, 18755494, 21703420, 21763080, 22160055, 22203728, 22614325, 22743134, 22907048, 23153582, 24490615, 24509625, 25559471, 25921060, 26133723, 27414060, 28665006, 29186933, 29609590, 29642597, 30679328, 31072226, 31428523		★☆☆☆☆ Found in Text Mining only
Anaplastic Large Cell Lymphoma, ALK-Positive	Anaplastic Lymphoma	ORPHANET_DG	12112524		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	21596819, 22810114, 24613930, 27696251, 28030793, 28351340, 30125543, 31526103		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	29535535		★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	24403104, 35446297	Associate	★☆☆☆☆ Found in Text Mining only
Angioendotheliomatosis	Angioendotheliomatosis	BEFREE	24805854		★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	19965671, 24481943, 25382608, 26431836, 29119842, 30317149		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	25017418		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	34298235	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23042012		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	25907517, 28069802, 28837676		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	28069802	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	16170336	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	10398126, 12202671, 12750159, 12816858, 12920229, 14586401, 15475930, 20207848, 20223922, 23457005, 23588372, 23599149, 28608720, 31335416, 9057627, 9684923		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	12763927, 18220322		★☆☆☆☆ Found in Text Mining only
Benign neoplasm of brain, unspecified	Brain Neoplasms	CTD_human_DG	22986231		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	27136744	Associate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	33939293, 34559836, 35446297, 35857126	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	19633684		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	CLINVAR_DG	22072639		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	CTD_human_DG	22986231		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain neoplasms	Pubtator	25624436, 25682925, 27598807, 28507205, 29269007, 30120912, 31287555, 31882485, 33011694, 34702773, 34964276, 35373538, 35645123, 35796015, 36868569, 37287428	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	CGI_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Tumor, Primary	Brain Neoplasms	CTD_human_DG	22986231		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12115586, 19275511, 22569898, 22845480, 23490651, 25257380, 26384210, 26529396, 31393373		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17490616, 17706593, 21076462, 26384210, 30305115, 32348852, 32822101	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	22296236, 23617234		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16170336	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16766651, 17131471, 21204709, 21656749, 23568951, 23741337, 24518094, 26687816, 27136744, 28167572, 34234737, 36337169, 36585857, 38451815	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	27803410, 28507205, 31559892, 40234130	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	15475930, 35438749, 35900506	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16709933, 18166835, 21076462, 21753699, 22998583, 23341890, 23484153, 23574788, 24277751, 24293609, 24419060, 24504521, 24515771, 25407901, 25557162, 26056079, 26603857, 27271776, 27606884, 27844328, 28185914, 28285687, 29336091, 30401947, 30523493		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	29109791	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24415871	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	32661669, 33237469, 34985683	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	23196793, 23738762, 29151522, 30978501, 33352665, 35200571, 37488608	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	28359267	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	26575266	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18320074, 18594010, 19032370, 19064915, 19170230, 19383809, 20418096, 20624322, 20926401, 20979473, 21103621, 21258247, 21272954, 21288922, 21356191, 21415216, 21430068, 21463141, 21587085, 21613408, 21753699, 21757253, 21847362, 21862980, 21888258, 21921848, 22129856, 22153831, 22266870, 22277784, 22327623, 22435662, 22553343, 22614325, 22735679, 22908099, 22912387, 22957484, 23060067, 23103072, 23246132, 23273562, 23325296, 23344087, 23401436, 23408463, 23489560, 23523007, 23551582, 23584297, 23612660, 23625156, 23696342, 23743932, 23787064, 23922677, 23932486, 23936355, 23993685, 24199682, 24361161, 24490607, 24495999, 24496003, 24556908, 24673736, 24750504, 24754584, 24755712, 24792336, 24842379, 24885886, 24952482, 24972969, 24984564, 24998601, 25002599, 25122422, 25170107, 25173427, 25184262, 25234288, 25238228, 25238939, 25248157, 25251827, 25265433, 25273224, 25302756, 25311215, 25403583, 25421750, 25468140, 25563851, 25579121, 25581823, 25594902, 25615851, 25618216, 25656847, 25677079, 25682546, 25695223, 25708242, 25714698, 25715771, 25721120, 25723109, 25745045, 25759024, 25760072, 25773789, 25789833, 25789835, 25813404, 25961702, 25971657, 25979929, 26076736, 26149475, 26219569, 26270443, 26301689, 26454747, 26491259, 26529396, 26599807, 26637667, 26667344, 26678488, 26682573, 26698910, 26703797, 26739884, 26925973, 26939704, 26973216, 26993609, 27031368, 27049722, 27070423, 27122312, 27132509, 27206799, 27432227, 27470969, 27472693, 27507192, 27552093, 27565908, 27599111, 27613526, 27637426, 27666124, 27686809, 27698100, 27707887, 27764703, 27769042, 27779369, 27783866, 27799390, 27811184, 27865624, 27879019, 27912827, 27974674, 28009326, 28032602, 28054318, 28103738, 28181564, 28182271, 28185914, 28316074, 28362192, 28363487, 28396832, 28450729, 28514730, 28521447, 28529640, 28549458, 28551680, 28628492, 28676219, 28721068, 28721071, 28735509, 28743163, 28763012, 28786099, 28805673, 28829490, 28860822, 28915678, 28970558, 28991240, 29048652, 29066738, 29134510, 29153898, 29173772, 29189709, 29217530, 29268561, 29280331, 29304828, 29307353, 29312572, 29336091, 29373100, 29507487, 29507657, 29507704, 29518553, 29632648, 29642598, 29650534, 29669761, 29684234, 29805631, 29856687, 29862659, 29885057, 29902067, 29930762, 30032847, 30066208, 30071258, 30074936, 30171175, 30174447, 30194140, 30271189, 30343450, 30429043, 30477470, 30506595, 30519133, 30582673, 30653748, 30659989, 30669647, 30673691, 30737231, 30811109, 30813562, 30829864, 30866974, 30886831, 30900377, 30902613, 30941048, 30959466, 30972901, 31023173, 31033499, 31114237, 31125274, 31138506, 31305295, 31318119, 31319969, 31328968, 31346927, 31354290, 31358542, 31374369, 31390053, 31412611, 31446141, 31480046, 31513617, 31559892, 31562206, 31585938, 31588629, 31633304, 31641223, 31654622, 31681574, 31707279		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	28167572	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	21076462, 23741400, 24698962, 27174587, 29905933, 31393391, 32102128, 32149365, 32251007, 32467651, 33166721, 34228212, 35238063, 35718773, 36447228, 39626326, 39695805	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	26751586, 26752677, 29317428, 29559559, 33166721	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22913857, 24565165, 24722159, 25527865, 27495736, 28546520, 30279110, 30401947, 32727606, 34257603, 34324792, 35058282, 35709927, 39518907	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	24163262, 28895885		★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	30734108		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	30154667		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22570254, 27271776		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	BEFREE	25270523, 27174587, 28081478		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	22705117, 23199529		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	28193280, 37530323	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	25312988	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	32681682	Associate	★☆☆☆☆ Found in Text Mining only
Castleman Disease	Castleman disease	Pubtator	34242968, 34431136	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	26531107		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	28183697, 39721825	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	28409069		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	38139220	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	39721825	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30429055		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	26485928		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30429055		★☆☆☆☆ Found in Text Mining only
Childhood Ganglioglioma	Ganglioglioma	BEFREE	28069802		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	22810114, 27179218, 28338501, 30523493		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	24983247	Associate	★☆☆☆☆ Found in Text Mining only
Choreoathetosis Hypothyroidism And Neonatal Respiratory Distress	Choreoathetosis	Pubtator	36150036	Associate	★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	22743654		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	31588629		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	24307515		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	26555338, 30997486		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	28199742		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	26433824, 29149104, 29675948, 29858024		★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	22743654		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	26172300, 36108931	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22327622, 22845480, 24129244, 24200637, 24296758, 24691006, 24992173, 25926053, 26172300, 26633560, 26678488, 26933125, 28095174, 29370427, 29955133, 31410188		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24129244, 24296758, 24691006, 25926053, 26172300, 26633560, 26678488, 26797410, 28368455, 28507204, 28675510, 29370427, 33414136, 35237889, 35785618, 36129915, 36746394, 37686416, 40184080	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	11331960, 11943732, 12163366, 12800156, 18220322, 22764207, 26358176, 27910030, 9561912, 9763551, 9885226		★☆☆☆☆ Found in Text Mining only
Conjunctivitis	Conjunctivitis	BEFREE	28844318		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	22743654		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24318419, 24698962, 24929890, 25753529, 27450657, 27554841, 27684973, 28199742, 29024210, 29405994, 30565301, 31563285, 31627758		★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	34941039	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Fibrous Histiocytoma	Fibrous Histiocytoma	BEFREE	24666231		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	19455469		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	17487225		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	BEFREE	20223922		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	19346957		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	31264924		★☆☆☆☆ Found in Text Mining only
Differentiated thyroid carcinoma	Thyroid Carcinoma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	25527510		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	12763927, 14576483, 15492998, 17277765, 17509395, 18220322, 18755494, 19074097, 19275511, 19521280, 19636007, 19734424, 21494621, 22808292, 23457005, 24717232, 27740969, 28551388, 29019447		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	LHGDN	14563642, 15004538		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	CTD_human_DG	22474449		★☆☆☆☆ Found in Text Mining only
Digestive System Neoplasms	Digestive system neoplasm	Pubtator	26678488	Associate	★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	26938871		★☆☆☆☆ Found in Text Mining only
Ear Diseases	Ear disease	Pubtator	31882485	Associate	★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	23307059, 29081033		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	30811109	Inhibit	★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	35081265	Associate	★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	24811761		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28193280		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	30068733, 37592266, 37686416	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Stromal Sarcoma	Endometrial Stromal Sarcoma	BEFREE	28787279		★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	27401149		★☆☆☆☆ Found in Text Mining only
Epithelioid and spindle cell nevus	Spitz nevus	BEFREE	30857967		★☆☆☆☆ Found in Text Mining only
Epithelioid hemangioendothelioma	Epithelioid Hemangioendothelioma	BEFREE	26763770		★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	17131471	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	12115586, 28756644, 7656205		★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	36864442	Associate	★☆☆☆☆ Found in Text Mining only
Eye Diseases	Eye disease	Pubtator	34864500	Associate	★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	27469327, 28731868, 31596959		★☆☆☆☆ Found in Text Mining only
Ganglioglioma	Ganglioglioma	BEFREE	28069802		★☆☆☆☆ Found in Text Mining only
Ganglioneuroblastoma	Ganglioneuroblastoma	BEFREE	22203052, 23797004		★☆☆☆☆ Found in Text Mining only
Ganglioneuroma	Ganglioneuroma	BEFREE	23797004		★☆☆☆☆ Found in Text Mining only
Gastric lymphoma	Gastric lymphoma	BEFREE	15492998		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	34864500	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	25468140		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	24938355		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	32005261, 33879132, 35319816, 37120571	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	11809760, 17904822		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	12115586, 15583856, 15986444, 17611412, 17694547, 17904822, 19177199, 19275511, 23686309, 27579614, 27993946, 28837676, 29336268, 31776900		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	15908427, 25500544, 27579614, 28837676, 33341678, 34341009, 34626238, 34702773, 35332262	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	12115586, 15986444, 17694547, 17904822, 19177199, 19275511, 23686309, 27579614, 27993946, 29336268, 31776900		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	21233844, 28756644		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	25500544, 28912153, 31554817, 32238360, 33341678, 34626238, 37271069, 37349135, 37503880	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	CGI_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gliosarcoma	Gliosarcoma	Pubtator	28193280	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease IIIA	Glycogen storage disease	Pubtator	28502721	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease IIIB	Glycogen storage disease	Pubtator	29526950, 29959809	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	25500544, 33382123	Associate	★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	26763770		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	11493472, 18242762, 24091028		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	11493472, 16254137, 25421750, 26384210, 33514657	Associate	★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	24613277		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	20223922		★☆☆☆☆ Found in Text Mining only
Hemophagocytic Syndrome	Hemophagocytic Syndrome	BEFREE	19863446		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	19722744	Associate	★☆☆☆☆ Found in Text Mining only
hereditary neuroblastoma	Neuroblastoma	BEFREE	18724359, 20731666, 21205076, 21504710, 21734404, 22673527, 23104988, 26503946, 26786851, 28455243, 28458126, 29317532, 29378002, 29589100, 30350464		★☆☆☆☆ Found in Text Mining only
hereditary neuroblastoma	Neuroblastoma	GENOMICS_ENGLAND_DG	18724359		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	28095174		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	22071890		★☆☆☆☆ Found in Text Mining only
Histiocytoma, Angiomatoid Fibrous	Histiocytoma	BEFREE	24666231, 29877921		★☆☆☆☆ Found in Text Mining only
Histiocytoma, Benign Fibrous	Benign fibrous histiocytoma	BEFREE	25857825, 26121314, 29327718, 29747676, 30289773		★☆☆☆☆ Found in Text Mining only
Histiocytosis	Histiocytosis	BEFREE	29224419, 30573850, 31351348, 31768065		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11090048, 14569815, 15475930, 16101126, 16140928, 19531656, 19734424, 22249260, 24043362, 25390351, 25615851, 28771164, 29024210, 29346274, 30093402, 7655001, 7662979, 8562933, 8683377, 8781433, 9209648, 9250148, 9638979, 9684923, 9886332		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	17071493		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	21531006, 26105086, 8547653, 8701985, 8781433, 9736036, 9886332	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28438234		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	28438234	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	31794146	Associate	★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	32681682	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25096400	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	31462708		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30997486		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	30997486	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	24404580, 7662979		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28057529, 28629962, 30629552		★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	CTD_human_DG	22215853		★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	22664824, 25803816		★☆☆☆☆ Found in Text Mining only
Inflammatory Myofibroblastic Tumor	Inflammatory Myofibroblastic Tumor	BEFREE	10383129, 10934142, 11284039, 11406658, 11485898, 11774173, 12112524, 12661011, 12750159, 12763927, 12787312, 12917640, 13679433, 14569815, 15095281, 15245952, 15330992, 15583856, 15778844, 15887977, 16161041, 16360423, 16651537, 16831032, 16984614, 16984620, 17063337, 17122505, 17163160, 17396140, 17414097, 17611412, 17656252, 17938159, 18400254, 18701132, 20979472, 21030459, 21164297, 21288922, 21430068, 21472870, 22034911, 22249260, 22280150, 22588194, 22646268, 22658521, 22664824, 23386486, 23696342, 24034896, 24666231, 24875859, 25028698, 25120743, 25406945, 25596129, 25612511, 25682942, 25723109, 25744866, 25772857, 26062823, 26647767, 26866354, 27155927, 27259007, 27271275, 27450657, 27565932, 27742657, 27846861, 28409069, 28490045, 28504207, 28664932, 28705706, 28731868, 28787259, 28787279, 28923119, 28977547, 29081033, 29163763, 29268561, 29286567, 29310405, 29455642, 29617048, 29643133, 29669701, 29739898, 29764851, 29877921, 29898011, 29900760, 29925295, 30015720, 30040458, 30451733, 30572472, 30697903, 30735274, 30735872, 30790150, 30813562, 30900517, 31009388, 31121144, 31202195, 31215130, 31326196, 31578734, 31615346, 31805529		★☆☆☆☆ Found in Text Mining only
Inflammatory Myofibroblastic Tumor	Inflammatory Myofibroblastic Tumor	ORPHANET_DG	17063337		★☆☆☆☆ Found in Text Mining only
Inflammatory myofibroblastic tumor	Inflammatory Myofibroblastic Tumor	Orphanet			★☆☆☆☆ Found in Text Mining only
Inflammatory Myofibroblastic Tumor	Inflammatory Myofibroblastic Tumor	CTD_human_DG	20979472, 21030459, 22920921		★☆☆☆☆ Found in Text Mining only
Inflammatory Myofibroblastic Tumor	Inflammatory Myofibroblastic Tumor	CGI_DG			★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	18085637		★☆☆☆☆ Found in Text Mining only
Iron deficiency anemia	Iron deficiency anemia	BEFREE	28652442		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	29437595		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	10194449, 10216106, 10362790, 10381534, 10398126, 10505771, 10552961, 10555007, 10556217, 10702393, 10706887, 10725869, 10757332, 10793082, 10994999, 11045569, 11090048, 11110708, 11178628, 11215285, 11310834, 11395396, 11441342, 11485911, 11493472, 11522649, 11532349, 11801565, 11943732, 11957137, 12112524, 12115586, 12181047, 12202671, 12213716, 12631617, 12644020, 12750159, 12763927, 12800156, 12917640, 14555389, 14560573, 14563642, 14569815, 14656879, 14962911, 15080301, 15093542, 15095281, 15117990, 15161657, 15161658, 15184887, 15208656, 15214912, 15297972, 15370244, 15385932, 15475930, 15583856, 15588951, 15713979, 15858125, 15894924, 15920698, 15948116, 15972965, 15990866, 16049513, 16108830, 16114011, 16127683, 16140928, 16189272, 16254137, 16304056, 16469875, 16533741, 16651537, 16709933, 16785248, 16825495, 16900211, 16954669, 16955462, 16966278, 16982741, 16984370, 16984614, 17077326, 17111047, 17163160, 17276937, 17320171, 17392503, 17416736, 17464320, 17483340, 17488663, 17512649, 17519389, 17537995, 17560012, 17610208, 17611412, 17690253, 17694547, 17695725, 17720243, 17914741, 18085637, 18097461, 18237230, 18275429, 18509351, 18832464, 19074096, 19131793, 19135051, 19249873, 19275511, 19358142, 19393834, 19423729, 19432678, 19459784, 19509496, 19531656, 19545284, 19554511, 19608866, 19657361, 19688153, 19722744, 19734424, 19737948, 19741726, 19863446, 19864230, 19887607, 19965671, 20015877, 20159827, 20179225, 20227918, 20448669, 20554525, 20669794, 20699364, 20934803, 20971950, 21030553, 21138864, 21343335, 21423761, 21502284, 21518927, 21575866, 21778999, 21844453, 21887344, 22042699, 22084369, 22107829, 22160055, 22203728, 22289917, 22414602, 22440390, 22612599, 22614325, 22726922, 22740451, 22773605, 22808292, 22810114, 22907048, 22998583, 23042012, 23135783, 23239810, 23598171, 23619105, 23633923, 23666701, 23673339, 23716562, 23741337, 23801630, 23851431, 23975180, 23999969, 24004669, 24043362, 24091028, 24112608, 24404580, 24509625, 24623571, 24666231, 24750504, 24766435, 24814516, 24878027, 25128227, 25145835, 25168906, 25193384, 25359993, 25382608, 25386922, 25390351, 25404214, 25416234, 25421750, 25444930, 25475421, 25533804, 25674293, 25688981, 25820993, 25874976, 25961697, 25961698, 25961699, 25961701, 25961702, 25979929, 25987255, 26018086, 26076736, 26104084, 26313373, 26338968, 26379148, 26379151, 26400099, 26431836, 26463425, 26529396, 26531107, 26657151, 26753883, 26809026, 27009859, 27414060, 27662658, 27694894, 27793034, 27864829, 27879258, 27910030, 28032129, 28061468, 28077299, 28112990, 28153507, 28340874, 28356514, 28414323, 28427693, 28485010, 28556361, 28581487, 28607076, 28626950, 28652442, 28659337, 28675026, 28735072, 28756644, 28787259, 28895885, 29035291, 29086626, 29119842, 29143801, 29150811, 29186933, 29346274, 29352732, 29455642, 29488330, 29510549, 29581862, 29588546, 29601554, 29602182, 29617304, 29660984, 29697184, 29758012, 29855693, 29898383, 29899875, 29905579, 30016448, 30028743, 30077013, 30082570, 30093402, 30131584, 30262555, 30339972, 30679328, 30692217, 30742941, 30813562, 30817557, 30830032, 30909793, 31052302, 31078446, 31101622, 31177400, 31383967, 31419130, 31423437, 31461013, 31495882, 31616703, 31618659, 31654627, 31667195, 31705818, 31706671, 31754210, 31804622, 7655001, 7655022, 7662979, 7772531, 7780128, 8558920, 8562933, 8616079, 8683377, 8721682, 8781434, 8866227, 9021682, 9028963, 9057627, 9094977, 9209450, 9209644, 9216718, 9250148, 9274957, 9337149, 9414185, 9517514, 9561912, 9598798, 9684923, 9763551, 9808552, 9885226, 9894470		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	LHGDN	12036886, 12112524, 12800156, 15161657, 16709933, 16825495, 17071493, 17077326, 17998938		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	CTD_human_DG	16151469, 19503098, 21345110, 22155737, 22920921, 22968692		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	19722744	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	31588629		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	31028202		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	27469327, 36806735	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	28731868, 30116888, 30518629, 31121144		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	31264439	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma, Myxoid	Leiomyosarcoma	BEFREE	30489320		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	16254137, 16955462	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	20223922, 25386922, 26032424		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30926971	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	29437595	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	25766836, 31346159		★☆☆☆☆ Found in Text Mining only
Leukocytoclastic vasculitis	Leukocytoclastic Vasculitis	BEFREE	29732013		★☆☆☆☆ Found in Text Mining only
LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	BEFREE	23453647, 27461700		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	31116035		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	30382607		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	25683346		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23453647, 24415871, 26753954, 27461700, 29570100, 30169533		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	26850068	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	30934130	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	12937132		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	12937132	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	20228600, 24651909, 24736082, 25527865, 29858031, 32375829, 35081265	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	31345828		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	26973324	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	26334220, 28373069, 28915678, 29656760, 30075548, 30521972, 30642448		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	18166835, 18320074, 18451166, 18593892, 18594010		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18320074, 20009909, 20179225, 20228600, 20526349, 20624322, 20979469, 20979473, 21062932, 21103621, 21258247, 21303969, 21921848, 22100693, 22277784, 23273562, 23344087, 23408463, 23484153, 23551194, 23552377, 23561259, 23562183, 23696342, 23743928, 23743932, 23922677, 23936355, 23979196, 24128714, 24174329, 24199682, 24200637, 24361161, 24495999, 24755712, 24759083, 24787965, 24885886, 25113306, 25173427, 25228532, 25234288, 25248157, 25311215, 25436807, 25477232, 25618216, 25656847, 25715771, 25745045, 25759024, 25789833, 25789835, 26219569, 26332764, 26487585, 26521903, 26555338, 26568007, 26599807, 26678488, 26791794, 26901483, 26925973, 26987388, 26992209, 26993609, 27009859, 27056998, 27070423, 27206799, 27245570, 27432227, 27470969, 27472693, 27507192, 27509978, 27565908, 27613526, 27668568, 27707887, 27753543, 27769042, 27796337, 27799390, 27811184, 27863497, 27879019, 27892978, 27974674, 28009326, 28032602, 28104537, 28145866, 28181564, 28362192, 28514730, 28549458, 28677170, 28914263, 28949084, 28955002, 28970558, 28991240, 29151522, 29199697, 29373100, 29559559, 29667179, 29862659, 29875142, 29877262, 29885057, 30032847, 30115026, 30580903, 30653139, 30653748, 30659989, 30673691, 30693893, 30866974, 30902917, 30943926, 30972901, 31160357, 31182981, 31358542, 31446141, 31480292, 31513617, 31559892, 31641223, 31662533, 31707279, 31726498, 31753813, 31794146, 31961053, 32086345, 32090101, 32164629, 32237210, 32441866, 32727606, 32756609, 32757294, 33011694, 33091333, 33131892, 33157918, 33161228, 33352665, 33402590, 33425389, 33495574, 33602172, 33872472, 33896820, 33939293, 33956842, 34173019, 34182952, 34234236, 34324792, 34378333, 34537440, 34558414, 34864500, 34964276, 35123209, 35253386, 35305401, 35322575, 35373538, 35435363, 35478149, 35628157, 35718095, 35726063, 35900560, 35927783, 35999456, 36042596, 36057739, 36086904, 36089134, 36146910, 36337169, 36493600, 36823653, 36864442, 36927974, 36996232, 37061247, 37069213, 37192591, 37269335, 37287428, 37339995, 37762506, 37934724, 38198957, 38307867, 39615410, 39908681, 40751559	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	20979469, 22100693, 22153831, 22412972, 22584871, 22661537, 22735679, 24775606, 24787965, 25650807, 25759024, 25789835, 26419961, 26626570, 26719536, 28093881, 29312572, 29505033, 29775614, 31374369		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31747139	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24422905, 27563816, 28887531, 29737033, 34985683	Associate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	19863446		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	16127683		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	10194450, 10552961, 10842190, 15475930, 16955462, 19088198, 19286999, 19531656, 20624322, 23338972, 25950466, 26187744, 26881551, 27974674, 32573700, 33246076, 33514657, 8781433, 9616164, 9736036, 9763551	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10398126, 10552961, 10555007, 10706887, 10807789, 10994999, 11522649, 11751994, 12115586, 12742158, 12816858, 12889041, 15095281, 15297972, 15475930, 15492998, 15894924, 16127683, 16189272, 16785248, 17611412, 17690253, 17720243, 18070987, 19088198, 19131793, 19233683, 19423729, 19521280, 19531656, 19734424, 19965671, 20159827, 20223922, 20227918, 20624322, 21030553, 21297223, 21494621, 21518927, 21778999, 21855232, 22998583, 23064464, 23338972, 23588372, 24632715, 24750504, 24878027, 25251827, 25961700, 26476082, 27662658, 27879258, 27974674, 28426485, 28485010, 28625797, 28659337, 28693234, 29352732, 29642597, 29905579, 31143519, 31177400, 7780128, 8122112, 8562957, 8701987, 8781433, 9121481, 9415224, 9490693, 9500471, 9616164, 9638979, 9684923, 9885226		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	12213716, 15161657, 17690253, 17904822, 17922009, 18097461, 18451166, 18923524		★☆☆☆☆ Found in Text Mining only
Lymphoma Primary Cutaneous Anaplastic Large Cell	Primary cutaneous anaplastic large cell lymphoma	Pubtator	10702393, 22565437, 22630575, 26458652, 33234878, 33547131	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	15475930, 19734424		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	27910030		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	10706887, 15095281, 17694547, 18923524, 21205076, 21763080, 21855232, 22086496, 26503946, 27686567, 27910030, 28551388, 29035291, 29602182, 29758012, 30588013, 30909793, 7780128, 8122112, 9057650, 9121481, 9174053		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	18923524		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	18923524, 21205076, 21763080, 22086496, 26503946, 27686567, 27910030, 29035291, 29602182, 29758012, 30909793, 8122112, 9057650, 9121481, 9174053		★☆☆☆☆ Found in Text Mining only
Lymphomatoid Papulosis	Lymphomatoid Papulosis	BEFREE	31705818, 8701987, 8781434, 9250148, 9415224, 9638979, 9684923		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	20223922, 22773605, 24878027, 26531107, 31705818, 8781433, 9449486		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	21656749, 8781433, 9449486	Associate	★☆☆☆☆ Found in Text Mining only
Lynch Syndrome	Lynch Syndrome	BEFREE	28095174		★☆☆☆☆ Found in Text Mining only
Maculopathy with diabetes mellitus	Diabetic maculopathy	GWASCAT_DG	31264924		★☆☆☆☆ Found in Text Mining only
Malignant Central Nervous System Neoplasm	Malignant neoplasm of the central nervous system	BEFREE	30140655		★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	14560573, 14569815, 20451371, 22266870, 23139213, 27986745, 29374774		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	24778081, 26179668, 30171198		★☆☆☆☆ Found in Text Mining only
Malignant Mesothelioma of Peritoneum	Peritoneal mesothelioma	BEFREE	26179668, 28910456, 30450291, 31783178		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	CTD_human_DG	22986231		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19275511, 22569898, 22845480, 23490651, 25257380, 26384210, 26529396		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	23490651, 26678488		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18166835, 18320074, 18451166, 18594010, 19032370, 19064915, 19170230, 19234440, 19383809, 20009909, 20179225, 20418096, 20526349, 20624322, 20926401, 20979469, 20979473, 21062932, 21103621, 21258247, 21272954, 21288922, 21356191, 21415216, 21430068, 21463141, 21587085, 21613408, 21753699, 21757253, 21829174, 21847362, 21850578, 21854543, 21862980, 21888258, 21921848, 21948233, 22010214, 22129856, 22153831, 22249260, 22266870, 22277784, 22296236, 22321987, 22327623, 22435662, 22553343, 22614325, 22735679, 22791881, 22908099, 22912387, 22957484, 23020707, 23060067, 23103072, 23178117, 23246132, 23273562, 23307186, 23325296, 23344087, 23385859, 23401436, 23408463, 23426121, 23449277, 23489560, 23523007, 23551194, 23551582, 23552377, 23562183, 23584297, 23612660, 23625156, 23661334, 23696342, 23724914, 23743928, 23743932, 23787064, 23922677, 23932486, 23936355, 23993685, 24192513, 24199682, 24277751, 24361161, 24490607, 24495999, 24496003, 24513263, 24518086, 24556908, 24621075, 24633422, 24673736, 24727987, 24750504, 24754584, 24755712, 24792336, 24842379, 24885803, 24885886, 24952482, 24972969, 24984564, 24998601, 25002599, 25122422, 25170107, 25173427, 25184262, 25234288, 25238228, 25238939, 25248157, 25251827, 25265433, 25273224, 25302756, 25311215, 25403583, 25421750, 25468140, 25563851, 25579121, 25581823, 25594902, 25615851, 25618216, 25656847, 25677079, 25682546, 25682925, 25695223, 25708242, 25714698, 25721120, 25723109, 25745045, 25759024, 25760072, 25766836, 25773789, 25789833, 25789835, 25813404, 25929953, 25971657, 25979929, 26076736, 26144315, 26149475, 26200268, 26219569, 26270443, 26275476, 26301689, 26454747, 26491259, 26503946, 26505450, 26529396, 26549034, 26599807, 26627242, 26637667, 26667344, 26678488, 26682573, 26698910, 26703797, 26739884, 26925973, 26939704, 26973216, 26993609, 27031368, 27049722, 27056998, 27070423, 27122312, 27132509, 27206799, 27354483, 27381270, 27401242, 27432227, 27460205, 27470969, 27472693, 27507192, 27552093, 27565908, 27599111, 27613526, 27637426, 27666124, 27686809, 27698100, 27707887, 27764703, 27779369, 27783866, 27799390, 27811184, 27865624, 27912827, 27974674, 28009326, 28032602, 28054318, 28077299, 28103738, 28181564, 28182271, 28185914, 28316074, 28362192, 28363487, 28396832, 28409069, 28435288, 28450729, 28514730, 28521447, 28529640, 28549458, 28551680, 28594000, 28628492, 28656214, 28676219, 28721068, 28721071, 28735509, 28743163, 28763012, 28786099, 28805673, 28829490, 28860822, 28872581, 28915678, 28970558, 28991240, 29045271, 29048652, 29066738, 29134510, 29153898, 29173772, 29189709, 29217530, 29268561, 29280331, 29300322, 29304828, 29307353, 29312572, 29336091, 29373100, 29507487, 29507657, 29507704, 29517858, 29518553, 29571990, 29632648, 29642598, 29650534, 29669761, 29684234, 29805631, 29856687, 29862659, 29885057, 29902067, 29930762, 30017832, 30032847, 30066208, 30071258, 30074936, 30171175, 30174447, 30194140, 30218431, 30233266, 30271189, 30297175, 30343450, 30429043, 30477470, 30506595, 30519133, 30582673, 30596074, 30653748, 30659989, 30662002, 30669647, 30673691, 30737231, 30811109, 30813562, 30829864, 30866974, 30886831, 30900377, 30902613, 30941048, 30959466, 30972901, 31023173, 31033499, 31114237, 31125274, 31138506, 31305295, 31318119, 31319969, 31328968, 31346927, 31354290, 31358542, 31374369, 31390053, 31412611, 31421257, 31446141, 31480046, 31513617, 31559892, 31562206, 31585938, 31588629, 31625265, 31633304, 31641223, 31654622, 31681574, 31707279, 31738426		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22570254, 27271776, 30734108		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23851431		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20526349		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	21596819, 24613930, 26857243, 30125543, 31539879		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12185581, 12505251, 13679433, 14560573, 14569815, 15095281, 15583856, 17094440, 17353907, 17396140, 17611412, 17694547, 18097461, 18166835, 18724359, 19064915, 19275511, 19459784, 19691112, 19737948, 20190816, 20624322, 20934803, 21288922, 21423761, 21474455, 21502284, 21526964, 21575866, 21613408, 21829174, 21847362, 22072639, 22086496, 22194472, 22203728, 22266870, 22311682, 22321987, 22347506, 22414602, 22494566, 22932897, 22998583, 23139213, 23273562, 23379755, 23401433, 23427294, 23490651, 23598171, 23931927, 23965898, 24060861, 24101047, 24149177, 24419060, 24478382, 24613277, 24675041, 24723496, 24736082, 24778081, 24811913, 25238228, 25238939, 25351743, 25458559, 25527510, 25590606, 25683346, 25708242, 25714698, 25971657, 25979929, 26020125, 26104084, 26149886, 26172300, 26258416, 26295973, 26384210, 26444240, 26503946, 26529396, 26633560, 26678488, 26720421, 26753883, 26755435, 26829319, 26933125, 26943457, 27009842, 27136744, 27237026, 27461605, 27461700, 27470969, 27491402, 27552093, 27573755, 27597280, 27836716, 27879258, 27974674, 28112990, 28183714, 28209203, 28346673, 28432815, 28489587, 28546520, 28557060, 28634201, 28656214, 28756644, 28857077, 28895885, 28987389, 29019447, 29054983, 29143801, 29165687, 29173772, 29352732, 29451020, 29455642, 29514107, 29559559, 29588308, 29609590, 29627725, 29650534, 29669701, 29669761, 29758012, 29776956, 29891519, 30006516, 30144282, 30150445, 30223120, 30322862, 30448735, 30453899, 30459281, 30591488, 30675269, 30721452, 30737231, 30778092, 30813562, 30900377, 30942451, 31139322, 31190983, 31278140, 31340850, 31366041, 31387567, 31393373, 31425908, 31462708, 31539879, 31569004, 31696059, 31804622, 9376569		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	24722159, 25973127		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30429055		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21076462		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	28675510		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	21297223		★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	10911802, 25688981	Associate	★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	26295973		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	22810114, 26474502, 27179218, 28338501, 30523493		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	27179218, 30523493	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	26444240, 26872010, 28895885, 29054983, 29683819, 29920315, 30290811, 30546443, 30771009		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	26872010, 30657954, 31900433, 32329859, 32815748, 35871080, 37475109	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CGI_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma Cutaneous Malignant	Melanoma	Pubtator	26872010, 29683819	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	17487225		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	23574788, 28359267, 28895885, 30588655		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	28910456, 31783178		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	28910456, 31783178, 33399341, 37400148	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	28910456, 32600123, 33399341, 37077094	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	30886831		★☆☆☆☆ Found in Text Mining only
MiT family translocation renal cell carcinoma	Renal Carcinoma	BEFREE	23957913		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	30134812		★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	25813151, 25839699, 27114375, 27271776, 28823574, 31285953		★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis IV	Mucopolysaccharidosis	Pubtator	36221356	Associate	★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	20621192		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	21855232		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	29654269, 34242968	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	34864500	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	24307515		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	24307515		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	30206237		★☆☆☆☆ Found in Text Mining only
Myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	24613277		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	24307515		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	25257756, 27060609, 28557526, 30886226		★☆☆☆☆ Found in Text Mining only
Myxoid/Round Cell Liposarcoma	Myxoid Liposarcoma	BEFREE	25683346		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	29367682	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	30596395	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10381534, 10383129, 10398126, 10514417, 10549257, 10552961, 10793082, 11090048, 11178628, 11280613, 11485911, 11493472, 11781220, 12163366, 12218210, 12456315, 12631617, 12816858, 13679433, 15095281, 15117990, 15161657, 15161658, 15184887, 15297972, 15583856, 15920698, 15948116, 15972965, 15990866, 16189272, 16254137, 16818631, 16900211, 16966278, 16984620, 17111047, 17488663, 17509395, 17511113, 17656252, 17695725, 17922009, 18400254, 18451166, 18509351, 18594010, 18701132, 18845790, 18923523, 18923524, 18927303, 19064915, 19074097, 19147828, 19330473, 19383809, 19386350, 19423729, 19519203, 19521280, 19656550, 19722744, 19734424, 20179225, 20183914, 20223922, 20699364, 20719933, 20934803, 20940188, 20952506, 20979469, 20979473, 21036415, 21062932, 21076462, 21107285, 21119513, 21233844, 21258247, 21258415, 21358343, 21423761, 21444946, 21474455, 21494621, 21502284, 21502504, 21513493, 21518927, 21575866, 21632861, 21753699, 21791641, 21823889, 21829174, 21847362, 21855164, 21862980, 21940108, 21945349, 21948233, 21972109, 22071650, 22071890, 22080568, 22085494, 22155737, 22184391, 22203052, 22203728, 22235099, 22277784, 22282308, 22286764, 22323827, 22414602, 22439933, 22465695, 22483782, 22484425, 22570254, 22584871, 22612599, 22614325, 22617243, 22658521, 22661537, 22705117, 22735679, 22743654, 22764207, 22771825, 22808292, 22810114, 22908099, 22912387, 22998583, 23108025, 23139213, 23150706, 23273562, 23277484, 23289484, 23307059, 23345154, 23360421, 23407559, 23426121, 23443800, 23453647, 23484153, 23598171, 23669222, 23696342, 23741400, 23743928, 23771519, 23787064, 23797004, 23801495, 23851431, 23887300, 23889739, 23932486, 23999969, 24022839, 24091028, 24091716, 24128714, 24138721, 24149177, 24163262, 24194854, 24221342, 24278035, 24290361, 24292963, 24300132, 24327273, 24346090, 24356251, 24360397, 24361161, 24403104, 24404580, 24419060, 24475247, 24490615, 24495999, 24496003, 24515771, 24518094, 24533074, 24598368, 24613930, 24633422, 24667968, 24673736, 24691006, 24698967, 24717232, 24736082, 24775606, 24787965, 24810493, 24814516, 24842379, 24856155, 24875859, 24885886, 24885982, 24887559, 24888607, 24947326, 24959902, 24965693, 24992173, 25017418, 25044104, 25122422, 25135623, 25144242, 25193384, 25205428, 25228590, 25234288, 25238939, 25251827, 25257756, 25312988, 25312989, 25351246, 25374304, 25394791, 25444930, 25556163, 25575117, 25576649, 25577516, 25602801, 25612511, 25612681, 25653133, 25683346, 25714698, 25749034, 25766836, 25773789, 25773866, 25805801, 25813404, 25820993, 25857825, 25882494, 25901525, 25921060, 25961699, 25961702, 26001149, 26005112, 26018086, 26032424, 26045865, 26097614, 26139079, 26149475, 26158441, 26178751, 26179668, 26258416, 26270443, 26299615, 26362998, 26381283, 26384210, 26419961, 26444240, 26446239, 26454342, 26469326, 26469915, 26503946, 26544515, 26547803, 26585927, 26599269, 26603857, 26620497, 26626570, 26633560, 26637667, 26667344, 26672084, 26687816, 26698910, 26747894, 26786851, 26789109, 26804638, 26809026, 26825369, 26872010, 26880345, 26892300, 26933125, 26945447, 26973203, 26973324, 26993609, 27009859, 27013395, 27056568, 27060609, 27076624, 27130468, 27137772, 27179218, 27271275, 27271776, 27354483, 27430882, 27460205, 27461700, 27469327, 27518729, 27564104, 27565907, 27565908, 27565911, 27573755, 27613526, 27662658, 27668568, 27740969, 27769042, 27776643, 27821131, 27830764, 27879258, 27912826, 27922734, 28065466, 28104537, 28112990, 28118634, 28122866, 28183714, 28185914, 28188721, 28189201, 28203297, 28316074, 28338501, 28356514, 28359267, 28364271, 28370702, 28409069, 28423360, 28455243, 28463570, 28469773, 28476735, 28490045, 28507793, 28534251, 28546523, 28601386, 28631135, 28664932, 28666189, 28675510, 28676342, 28705706, 28732214, 28756644, 28771164, 28787324, 28805682, 28811082, 28823574, 28840008, 28843992, 28887531, 28895885, 28910456, 28970558, 28977547, 29048652, 29079636, 29081033, 29093346, 29109791, 29109998, 29143801, 29191776, 29246182, 29268561, 29290262, 29300322, 29312572, 29321660, 29327718, 29336091, 29336268, 29343688, 29357780, 29361925, 29369502, 29370427, 29374774, 29378002, 29455675, 29487011, 29495603, 29507657, 29515255, 29535836, 29545095, 29559559, 29587818, 29599410, 29637735, 29642597, 29669701, 29683819, 29707333, 29737033, 29755689, 29794871, 29801706, 29805631, 29855693, 29863955, 29885479, 29897634, 29898011, 29900760, 29923908, 30010043, 30015720, 30040458, 30108370, 30116888, 30125543, 30225784, 30255803, 30290811, 30322862, 30382607, 30401947, 30420593, 30429043, 30429055, 30466405, 30489320, 30504104, 30518629, 30523493, 30642440, 30653748, 30657349, 30659989, 30675302, 30692217, 30721452, 30724750, 30737231, 30741845, 30778092, 30791979, 30793172, 30813562, 30892989, 30946933, 30959466, 30985604, 30994389, 31050216, 31072612, 31119775, 31151983, 31154543, 31166373, 31177400, 31217479, 31340850, 31358542, 31372957, 31374369, 31387567, 31410188, 31439588, 31447007, 31454018, 31482479, 31489711, 31493794, 31539879, 31540894, 31616196, 31633304, 31677810, 31699471, 31712133, 31737311, 31746406, 31804622, 8683377, 9057627, 9376569, 9490693, 9643564, 9684923, 9763551		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	CTD_human_DG	22986231		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	25205428, 31527380		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	26005112		★☆☆☆☆ Found in Text Mining only
Nervous System Neoplasms	Nervous System Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neural crest tumor	Neural Crest Tumor	BEFREE	17611412		★☆☆☆☆ Found in Text Mining only
Neural crest tumor	Neural Crest Tumor	ORPHANET_DG	18923523		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10793082, 12115586, 12185581, 15583856, 15972965, 17611412, 17904822, 18451166, 18724359, 18923523, 18923524, 18923525, 18990089, 19275511, 19393834, 19656550, 19723661, 19737948, 19840520, 20054657, 20190816, 20451371, 20576349, 20632993, 20719933, 20957039, 21030459, 21059859, 21107285, 21205076, 21487394, 21625996, 21632861, 21731748, 21734404, 21829174, 21838707, 21940108, 21945349, 21948233, 21972109, 21989914, 22071890, 22072639, 22085494, 22086496, 22142829, 22203052, 22249260, 22266870, 22286764, 22414602, 22439933, 22479414, 22484425, 22588779, 22589483, 22673527, 22764207, 22932897, 23084186, 23104988, 23139213, 23360421, 23598171, 23696342, 23797004, 23801497, 23889739, 23965898, 24116381, 24276038, 24356251, 24667968, 24714808, 24811913, 24830726, 24947326, 25071110, 25188507, 25228590, 25251827, 25351246, 25351247, 25422239, 25450694, 25517749, 25652313, 25653133, 25805801, 25882494, 25961702, 26059187, 26067621, 26122839, 26299615, 26309160, 26362998, 26438783, 26517508, 26554404, 26616860, 26687816, 26735175, 26747894, 26786851, 27009842, 27049722, 27179218, 27684973, 27707976, 27830764, 27879258, 27888620, 27986745, 28030793, 28069802, 28077299, 28178969, 28326957, 28338501, 28350380, 28425916, 28432815, 28455243, 28546523, 28602975, 28665006, 28666189, 28676342, 28756644, 28787429, 28800395, 28915608, 29027209, 29081033, 29084134, 29184034, 29186933, 29203817, 29290991, 29321660, 29371588, 29374774, 29455642, 29515255, 29535836, 29555900, 29559559, 29589100, 29638111, 29642598, 29660984, 29753117, 30013190, 30375995, 30425456, 30459281, 30459283, 30538293, 30605844, 30778092, 30793172, 30803032, 30848386, 30867324, 30982079, 31043380, 31058082, 31092383, 31218818, 31262882, 31334113, 31340081, 31419130, 31420353, 31452835, 31542727, 31614113, 31780656		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Neuroblastoma	Neuroblastoma	Pubtator	10793082, 15972965, 18724359, 20957039, 21030459, 21107285, 21625996, 21731748, 21734404, 21922652, 21948233, 22071890, 22072639, 22142829, 22192458, 22203052, 22266870, 22414602, 22479414, 23308108, 23334666, 23360421, 23598171, 23696342, 23991058, 24205241, 24293393, 25517749, 25653133, 25950466, 26067621, 26309160, 26362998, 26517508, 26616860, 26687816, 26735175, 27009842, 27009859, 27655666, 27732954, 27888620, 27997549, 28069802, 28350380, 28423360, 28521285, 28546523, 28602975, 29081033, 29203817, 29559559, 29660984, 30375995, 30605844, 30778092, 30789735, 30793172, 30952905, 31614113, 31747416, 32336043, 32858250, 33056981, 33568345, 33915956, 33932101, 34115544, 34210658, 34250393, 34250410, 34273261, 34815394, 35689207, 36029175, 36108156, 36493725, 36571449, 37147298, 37161925, 37664946, 37964559, 38007466, 38451815, 39177282	Associate	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Neuroblastoma	Neuroblastoma	LHGDN	12185581, 17904822, 18451166, 18923525		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Neuroblastoma	Neuroblastoma	ORPHANET_DG	18923523		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Neuroblastoma	Neuroblastoma	Orphanet			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Neuroblastoma	Neuroblastoma	CTD_human_DG	20576349, 21823617, 21859094, 22072639, 22286764, 22588779, 22789543, 22920921, 22932897, 22968692, 23104988, 23334666		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Neuroblastoma	Neuroblastoma	CGI_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	23851431		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	21949657, 24278035, 28057529, 28629962		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	31116035		★☆☆☆☆ Found in Text Mining only
Nevus, Blue	Blue Nevus	BEFREE	29923908		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17625570, 18166835, 18242762, 18320074, 18593892, 18594010, 18927303, 19032370, 19064915, 19147828, 19170230, 19386350, 19393834, 19459784, 19734424, 20009909, 20130484, 20183914, 20418096, 20624322, 20659620, 20921461, 20934803, 20943620, 20952506, 20979469, 21107285, 21168933, 21233671, 21258247, 21258415, 21278610, 21288922, 21336183, 21356191, 21502504, 21526964, 21562939, 21575866, 21587085, 21623265, 21642865, 21656749, 21720997, 21753699, 21757253, 21767331, 21791641, 21823889, 21844131, 21850578, 21888258, 21933749, 21953013, 22010214, 22034911, 22050016, 22082640, 22086654, 22129856, 22157554, 22162641, 22215748, 22235099, 22277784, 22282074, 22311682, 22323876, 22334442, 22414602, 22465695, 22483782, 22494566, 22506598, 22547770, 22551539, 22568572, 22569898, 22584871, 22612599, 22614968, 22622260, 22706607, 22722791, 22736493, 22742552, 22743654, 22771825, 22845480, 22908099, 22912388, 22932897, 22964709, 22986231, 22989574, 22991232, 22998583, 23020707, 23020724, 23060582, 23103072, 23154552, 23181703, 23182148, 23196275, 23239810, 23246132, 23277484, 23288638, 23325296, 23341890, 23344087, 23370315, 23379755, 23385859, 23400546, 23400671, 23401433, 23401445, 23407559, 23423768, 23427294, 23434628, 23443800, 23453647, 23472711, 23484153, 23499337, 23505007, 23533265, 23551582, 23584297, 23584342, 23598171, 23612660, 23617353, 23639470, 23656699, 23664446, 23669200, 23669222, 23683257, 23683537, 23696342, 23714228, 23729361, 23741400, 23743928, 23769207, 23771519, 23801495, 23809060, 23814043, 23819947, 23841470, 23897899, 23911227, 23930754, 23931927, 23936355, 23951022, 23955278, 24022839, 24022905, 24060861, 24088065, 24091716, 24101047, 24114583, 24128714, 24134423, 24138716, 24138721, 24183104, 24192124, 24199682, 24258572, 24293609, 24300132, 24327273, 24346090, 24346098, 24360322, 24361161, 24370118, 24389440, 24403104, 24404167, 24418728, 24419060, 24419423, 24443522, 24486058, 24495999, 24496003, 24515771, 24518086, 24556908, 24567430, 24573551, 24598368, 24611674, 24612196, 24621075, 24648382, 24670165, 24673736, 24674157, 24675041, 24722154, 24723496, 24736067, 24736079, 24736082, 24750504, 24789032, 24792336, 24810493, 24815447, 24842379, 24856155, 24859689, 24878018, 24885803, 24885982, 24887559, 24888607, 24889366, 24891360, 24925809, 24942490, 24952482, 24959902, 24972969, 24982390, 24992725, 24998601, 25053852, 25096400, 25101329, 25119973, 25135623, 25144242, 25153496, 25153538, 25170012, 25170107, 25170635, 25170637, 25193384, 25198510, 25205428, 25228534, 25247338, 25248157, 25257756, 25264305, 25288236, 25301075, 25312989, 25349307, 25351246, 25351743, 25360721, 25372020, 25381900, 25386659, 25393795, 25393796, 25403583, 25407901, 25413260, 25434695, 25436798, 25436802, 25456124, 25458559, 25501361, 25502629, 25534130, 25556163, 25558789, 25576294, 25581823, 25588859, 25590606, 25592111, 25601484, 25601488, 25612681, 25624436, 25656847, 25682925, 25706305, 25708242, 25715771, 25724526, 25733882, 25736571, 25740311, 25749034, 25754348, 25757141, 25757678, 25769414, 25789833, 25801645, 25813151, 25813404, 25839699, 25842168, 25847523, 25876560, 25898958, 25901525, 25910841, 25914136, 25922063, 25929953, 25953441, 25956936, 25961702, 25963091, 25964523, 25964588, 25979929, 26001149, 26019170, 26020125, 26045026, 26045865, 26056079, 26073862, 26076736, 26107243, 26107553, 26122839, 26142544, 26168728, 26193985, 26229087, 26259641, 26270443, 26275476, 26291013, 26294238, 26334220, 26352533, 26358176, 26389762, 26415994, 26419961, 26433824, 26438117, 26439599, 26454342, 26454747, 26464158, 26477969, 26485928, 26491259, 26504000, 26505450, 26517679, 26519123, 26520640, 26529396, 26536196, 26537995, 26544515, 26547803, 26555338, 26556876, 26568289, 26582431, 26585927, 26599807, 26627242, 26639656, 26650486, 26654422, 26667344, 26677785, 26712101, 26719536, 26739884, 26755435, 26775591, 26786851, 26789109, 26802023, 26823131, 26825369, 26849637, 26870817, 26888425, 26892300, 26898615, 26916631, 26938871, 26943457, 26945447, 26951079, 26973202, 26973203, 26973216, 26973324, 26990744, 26992209, 26992917, 26993609, 27022118, 27028394, 27031368, 27040858, 27043019, 27045755, 27060609, 27078848, 27109446, 27119231, 27122312, 27130468, 27137772, 27197808, 27206799, 27225694, 27232673, 27237026, 27245569, 27262325, 27266545, 27270784, 27298405, 27318655, 27322143, 27328177, 27338643, 27354483, 27359268, 27387984, 27401242, 27401797, 27405684, 27418132, 27432917, 27441499, 27460205, 27461700, 27472693, 27480287, 27491402, 27495736, 27500967, 27523323, 27533086, 27545757, 27545871, 27561692, 27562706, 27564104, 27565911, 27573752, 27573755, 27573756, 27602773, 27606884, 27607176, 27635639, 27637426, 27666124, 27668568, 27693505, 27744726, 27748834, 27753543, 27756333, 27764703, 27766783, 27779369, 27780368, 27780805, 27804873, 27835601, 27835868, 27836576, 27836716, 27841077, 27865624, 27879019, 27899405, 27912826, 27913214, 27926526, 27987587, 28007627, 28024689, 28024691, 28027105, 28029301, 28035616, 28039177, 28054318, 28065466, 28073897, 28077299, 28081478, 28095174, 28111120, 28126333, 28147239, 28176528, 28176910, 28182271, 28183714, 28185914, 28189201, 28193771, 28209203, 28238961, 28245558, 28274158, 28276856, 28277868, 28285691, 28285695, 28290719, 28296581, 28303028, 28318251, 28332225, 28332433, 28342113, 28342334, 28346673, 28361443, 28362192, 28363487, 28364271, 28369553, 28370702, 28373069, 28374971, 28383810, 28405961, 28419723, 28423535, 28424965, 28427013, 28427213, 28433570, 28450729, 28460468, 28463570, 28475456, 28501140, 28507793, 28514730, 28520828, 28528303, 28534101, 28534251, 28557060, 28578501, 28586279, 28597393, 28600466, 28601386, 28602779, 28606126, 28622610, 28624922, 28646771, 28656214, 28656792, 28667686, 28668874, 28669346, 28676215, 28676219, 28689043, 28696381, 28701030, 28705139, 28729021, 28730760, 28732214, 28740365, 28741662, 28742247, 28745554, 28763012, 28763691, 28780976, 28795492, 28805673, 28805682, 28806935, 28811082, 28829490, 28832416, 28838397, 28838404, 28843992, 28850922, 28864950, 28882182, 28887531, 28891712, 28915678, 28930717, 28938646, 28960893, 28970558, 28979145, 29032042, 29045514, 29048652, 29061835, 29066738, 29074098, 29075144, 29079636, 29088872, 29088875, 29091425, 29101158, 29118432, 29119148, 29123416, 29123433, 29134510, 29135281, 29137103, 29143897, 29149104, 29153898, 29164298, 29173772, 29174221, 29184034, 29184673, 29184678, 29186933, 29187012, 29190913, 29191580, 29191776, 29226313, 29251824, 29256901, 29263703, 29268417, 29269007, 29275314, 29286485, 29290262, 29298713, 29300322, 29304828, 29312572, 29317835, 29323742, 29327716, 29331646, 29336091, 29343688, 29352732, 29357780, 29363116, 29373100, 29383034, 29383158, 29400604, 29413046, 29436187, 29437006, 29444468, 29451020, 29455091, 29455642, 29455675, 29458050, 29458286, 29458783, 29463284, 29467147, 29476608, 29488070, 29488330, 29491259, 29494220, 29495603, 29505033, 29506392, 29507494, 29507657, 29507704, 29510386, 29517860, 29518553, 29523116, 29535535, 29536761, 29545095, 29563138, 29571990, 29582563, 29587667, 29587818, 29595984, 29596029, 29596910, 29599410, 29601554, 29632648, 29642919, 29648831, 29656744, 29660984, 29661733, 29666949, 29668860, 29675948, 29714122, 29732013, 29736685, 29737033, 29738763, 29742496, 29744867, 29748847, 29754556, 29764505, 29768118, 29768119, 29774063, 29774128, 29776956, 29777599, 29785088, 29796191, 29801706, 29805608, 29805631, 29805713, 29808239, 29855693, 29858024, 29862230, 29885057, 29902067, 29915924, 29925295, 29930762, 29935304, 29937385, 29937933, 29944008, 29950554, 29950868, 29951342, 29959809, 29966800, 29971546, 29978950, 29981925, 29997961, 29997966, 30001602, 30006516, 30010043, 30010763, 30025202, 30030733, 30032847, 30052269, 30052658, 30059431, 30066208, 30071258, 30088010, 30088419, 30089600, 30090122, 30095326, 30105645, 30108370, 30108712, 30124125, 30138764, 30142403, 30148862, 30165392, 30174447, 30176786, 30188361, 30191596, 30194140, 30198357, 30205166, 30215676, 30218431, 30228011, 30230699, 30233874, 30236141, 30251885, 30253203, 30257437, 30271189, 30273505, 30280657, 30286627, 30290287, 30298279, 30327151, 30340555, 30348720, 30352060, 30362839, 30366200, 30367285, 30381078, 30391211, 30394941, 30408570, 30413378, 30416687, 30453899, 30459281, 30464681, 30466405, 30476657, 30477470, 30480312, 30505716, 30521972, 30522123, 30529852, 30534706, 30543838, 30555260, 30568455, 30570839, 30572795, 30572846, 30576255, 30580372, 30586539, 30599201, 30604291, 30608384, 30612418, 30620668, 30629552, 30638036, 30642448, 30642546, 30642550, 30642552, 30642554, 30649741, 30652510, 30653748, 30657349, 30657798, 30658713, 30659989, 30660696, 30669647, 30683630, 30687633, 30688675, 30718102, 30729850, 30741758, 30771874, 30775023, 30776174, 30786826, 30791979, 30796032, 30803032, 30804663, 30804692, 30807604, 30811109, 30813562, 30817606, 30822515, 30829864, 30840206, 30843662, 30851442, 30854949, 30863883, 30864106, 30865033, 30866974, 30867736, 30878128, 30878193, 30882666, 30885345, 30885353, 30886226, 30888598, 30892989, 30895431, 30898567, 30900201, 30900377, 30902613, 30914465, 30920172, 30920858, 30926356, 30938103, 30952742, 30952820, 30954906, 30959466, 30964529, 30976989, 30981696, 30985604, 30993895, 31002952, 31005443, 31008509, 31020351, 31023173, 31027700, 31033499, 31045816, 31050216, 31097098, 31109722, 31116035, 31117044, 31118681, 31125274, 31138727, 31140869, 31144459, 31147208, 31151782, 31154543, 31164317, 31166373, 31179082, 31190983, 31213769, 31217479, 31243098, 31260890, 31287555, 31318119, 31320002, 31328968, 31338990, 31345828, 31346927, 31354290, 31362880, 31375452, 31382924, 31388026, 31401883, 31407528, 31410188, 31419130, 31425908, 31435660, 31439588, 31444835, 31446141, 31463119, 31482479, 31489711, 31491676, 31497071, 31509890, 31521978, 31523585, 31527380, 31545260, 31564978, 31576479, 31608224, 31612052, 31613427, 31616158, 31616196, 31628085, 31630043, 31630357, 31634667, 31648302, 31654622, 31654838, 31656659, 31663274, 31668406, 31669591, 31681574, 31696059, 31699471, 31706099, 31707279, 31708389, 31712133, 31712989, 31717403, 31720561, 31721468, 31745593, 31746406, 31749634, 31756496, 31770246, 31778798, 31780656, 31794921, 31795298, 31803366, 31804301, 31809604, 31812890, 31812932, 31820329, 31827192		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	17625570, 20979469, 20979473, 21102269, 21336183, 21587085, 21757253, 21767331, 21791641, 21823889, 21904575, 21933749, 22215748, 22277784, 22282074, 22286583, 22508824, 22568572, 22617245, 22713522, 22787409, 22887466, 22920921, 22954507, 22968692, 22986231, 23020724, 23686600		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30354850, 30622805, 30640563		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	35057767	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	22570254, 27271776		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	27599579, 28362192, 31455365	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Mucinous Adenocarcinoma	Ovarian adenocarcinoma	BEFREE	27271776		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28362192, 31455365, 34214505, 37522200	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	BEFREE	27271776		★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23851431		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	23851431, 25017418		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	23851431		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	22743654		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23050789, 24475247, 25501013, 28293988, 31539879		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	ORPHANET_DG	25148236, 25501013		★☆☆☆☆ Found in Text Mining only
Partial Trisomy	Trisomy	BEFREE	24276038		★☆☆☆☆ Found in Text Mining only
Pericardial Effusion	Pericardial effusion	Pubtator	35347923	Associate	★☆☆☆☆ Found in Text Mining only
Perineurioma	Perineurioma	BEFREE	16096405		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	35660971	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	17511113, 17512649, 18085637, 18341637, 18832464, 19074097, 19233683, 19965671, 20159827, 21138864, 21887344, 22740451, 24481943, 24632715, 27793034, 28485010, 28516671, 29119842, 29363227, 29538376, 29549411, 30420593		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	26872010, 28910456, 31783178	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	34234737	Associate	★☆☆☆☆ Found in Text Mining only
Plasma Cell Granuloma, Pulmonary	Granulomas	BEFREE	11331960		★☆☆☆☆ Found in Text Mining only
Plasma Cell Granuloma, Pulmonary	Granulomas	CTD_human_DG	21430068		★☆☆☆☆ Found in Text Mining only
Pleural Diseases	Pleural diseases	Pubtator	22282022, 24815447, 39844176	Associate	★☆☆☆☆ Found in Text Mining only
Pleural Diseases	Pleural diseases	Pubtator	30741758	Stimulate	★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	24885982, 25956936, 27060609, 28374971, 29637735		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	26032424		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	16127683		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	19455469		★☆☆☆☆ Found in Text Mining only
Primary Cutaneous Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	10702393, 11090048, 15214912, 15475930, 15713979, 15894924, 17387297, 18085637, 18670345, 19074097, 22565437, 22773605, 24666231, 28895885, 29057463, 31705818, 9415224		★☆☆☆☆ Found in Text Mining only
Primary malignant neoplasm of brain	Brain Neoplasms	CTD_human_DG	22986231		★☆☆☆☆ Found in Text Mining only
Primary peritoneal carcinoma	Peritoneal Carcinoma	BEFREE	28081478, 29310482		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20526349		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20526349, 29559559, 36337169	Associate	★☆☆☆☆ Found in Text Mining only
Psammomatous Meningioma	Psammomatous Meningioma	BEFREE	24194854, 25557162		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	34864500	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26555338	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	30997486	Associate	★☆☆☆☆ Found in Text Mining only
Recurrent Brain Neoplasm	Brain Neoplasms	CTD_human_DG	22986231		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	23957913		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	22743654		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23957913, 24318419, 24698962, 25753529, 26773439, 26848800, 27450657, 27554841, 27684973, 28181950, 28199742, 29024210, 29405994, 29905933, 30813562, 31563285, 31627758, 31677810		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	25436798, 28035616, 28721071		★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	29067644		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	19064915, 26938871		★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	BEFREE	8781433, 9638979, 9684923		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	12115586		★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	30523493		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	18788887, 22184391, 23307059, 23578105, 23922356, 24149177, 24326270, 26005112, 26445453, 27385213, 28069802, 28756644, 29045271, 29067644, 29186933, 30867324, 31383960		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Rhabdomyosarcoma	Rhabdomyosarcoma	CLINVAR_DG	22184391		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	23307059, 23578105, 24149177, 26147305, 26445453, 27385213	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Rhabdomyosarcoma	Rhabdomyosarcoma	CGI_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	23307059	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Embryonal	Rhabdomyosarcoma	Pubtator	23307059, 27385213	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	32661669, 33237469	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	30909793		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	17694547, 21164297, 22705117, 22808292, 23988776, 24277751, 24903964, 25028698, 25270523, 25300797, 25557162, 26823889, 27468968, 27874193, 28535796, 29877921, 29925295, 30382607, 31578734		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	25300797, 26121314, 26139079, 28713152, 29081033, 32997436, 35131778, 35438749, 37726067, 39188081	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	18942305	Associate	★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	22743654		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	16604305		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	16604305		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	28368455, 29370427		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	37271069	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29046432, 30541790, 30541792, 30820191, 31472096		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	23574788, 23787064, 26752677, 27987586, 28111120, 29173772, 29808239, 30214557, 30771009, 30790327, 30900377, 31794921		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	24828667, 26751586, 26752677, 28285684, 35596192, 36054506, 36207130, 37142267	Associate	★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	20979472, 25683346, 26684580, 30187985		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17694547, 19275511, 19386350, 23196793, 23423768, 23453647, 23490651, 23568951, 23743928, 24194854, 24722159, 25527865, 25973127, 26549034, 26603857, 26973202, 27461700, 27495736, 27987587, 28683775, 29610932, 30025476, 30268457, 30642554, 30885334, 30959466, 31494736		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23568951, 31028202, 35478149, 39773366	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	23499398, 23661334, 24158231, 25973127, 26519123, 26603857, 28546520, 28683775, 29844868, 30279110, 30885334, 30959466		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29856687		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	31462708		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26172300, 28735509		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25882375, 28923119	Associate	★☆☆☆☆ Found in Text Mining only
Subcutaneous panniculitis-like T-cell lymphoma	Subcutaneous Panniculitis-Like T-Cell Lymphoma	BEFREE	21763080		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	28634201		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	11781220, 12213716, 17353907, 18085637, 19074097, 19423729, 19657361, 20159827, 21102525, 22440390, 22681779, 23338972, 23975180, 24218456, 24894770, 25359993, 25884514, 25987255, 26379148, 26476082, 26531107, 27879258, 28557340, 28625797, 28652442, 31340850, 31423437, 31610171, 31804622		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	LHGDN	16766651		★☆☆☆☆ Found in Text Mining only
T-Cell Prolymphocytic Leukemia	T-Cell Prolymphocytic Leukemia	BEFREE	18085637, 26379148		★☆☆☆☆ Found in Text Mining only
Thoracic Diseases	Thoracic disease	Pubtator	25312988	Associate	★☆☆☆☆ Found in Text Mining only
Thoracic Diseases	Thoracic Diseases	BEFREE	30793172		★☆☆☆☆ Found in Text Mining only
Thoracic Neoplasms	Thoracic neoplasm	Pubtator	30550870	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	BEFREE	16831032		★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	Pubtator	16831032	Associate	★☆☆☆☆ Found in Text Mining only
Thromboembolism	Thromboembolism	Pubtator	33314597, 40751559	Associate	★☆☆☆☆ Found in Text Mining only
Thromboembolism	Thromboembolism	Pubtator	36493600	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	26295973	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	23050789, 25501013, 28209747, 29633575, 30664823, 31539879, 32187423, 33878728, 35397361, 36150036, 37733241, 40338900	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	21596819, 24475247, 24613930, 25500544, 26857243, 30125543, 31539879		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	28209747, 28489587, 30758123	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	21596819, 24613930, 26857243, 30125543, 31539879		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	24475247, 24613930, 25500544, 28013235, 29165687, 31539879, 32737449, 33878728, 36585857, 37622214	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	31539879		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29475913, 32558176	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25500544, 33007314	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	25083769		★☆☆☆☆ Found in Text Mining only
Uterine Carcinosarcoma	Endometrial Cancer	BEFREE	28193280		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	40317966	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	26155992	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	29900760	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	27469327, 28731868, 31596959		★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	26062823, 36806735	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Malformation Primary Intraosseous	Vascular malformation	Pubtator	27846861	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Neoplasms	Vascular neoplasm	BEFREE	30382607		★☆☆☆☆ Found in Text Mining only
Vasculitis Leukocytoclastic Cutaneous	Vasculitis	Pubtator	19722744, 9449486	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis, Leukocytoclastic, Cutaneous	Vasculitis	BEFREE	29732013		★☆☆☆☆ Found in Text Mining only