Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23764
Gene name	MAF bZIP transcription factor F
Gene symbol	MAFF
Synonyms (NCBI Gene)	U-MAFhMafF
Chromosome	22
Chromosome location	22q13.1
Summary	The protein encoded by this gene is a basic leucine zipper (bZIP) transcription factor that lacks a transactivation domain. It is known to bind the US-2 DNA element in the promoter of the oxytocin receptor (OTR) gene and most likely heterodimerizes with o

128

Show/Hide all (128)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018523	hsa-miR-335-5p	Microarray	18185580
MIRT706868	hsa-miR-4781-3p	HITS-CLIP	21572407
MIRT706867	hsa-miR-6499-3p	HITS-CLIP	21572407
MIRT706866	hsa-miR-31-3p	HITS-CLIP	21572407
MIRT706865	hsa-miR-3135b	HITS-CLIP	21572407
MIRT706864	hsa-miR-504-3p	HITS-CLIP	21572407
MIRT706863	hsa-miR-122-5p	HITS-CLIP	21572407
MIRT706862	hsa-miR-3652	HITS-CLIP	21572407
MIRT706861	hsa-miR-4430	HITS-CLIP	21572407
MIRT706860	hsa-miR-4466	HITS-CLIP	21572407
MIRT706859	hsa-miR-675-5p	HITS-CLIP	21572407
MIRT706858	hsa-miR-143-5p	HITS-CLIP	21572407
MIRT706857	hsa-miR-6501-5p	HITS-CLIP	21572407
MIRT706856	hsa-miR-4423-5p	HITS-CLIP	21572407
MIRT706855	hsa-miR-744-3p	HITS-CLIP	21572407
MIRT706854	hsa-miR-6885-3p	HITS-CLIP	21572407
MIRT706853	hsa-miR-5698	HITS-CLIP	21572407
MIRT706868	hsa-miR-4781-3p	HITS-CLIP	21572407
MIRT706867	hsa-miR-6499-3p	HITS-CLIP	21572407
MIRT706866	hsa-miR-31-3p	HITS-CLIP	21572407
MIRT706865	hsa-miR-3135b	HITS-CLIP	21572407
MIRT706864	hsa-miR-504-3p	HITS-CLIP	21572407
MIRT706863	hsa-miR-122-5p	HITS-CLIP	21572407
MIRT706862	hsa-miR-3652	HITS-CLIP	21572407
MIRT706861	hsa-miR-4430	HITS-CLIP	21572407
MIRT706860	hsa-miR-4466	HITS-CLIP	21572407
MIRT706859	hsa-miR-675-5p	HITS-CLIP	21572407
MIRT706858	hsa-miR-143-5p	HITS-CLIP	21572407
MIRT706857	hsa-miR-6501-5p	HITS-CLIP	21572407
MIRT706856	hsa-miR-4423-5p	HITS-CLIP	21572407
MIRT706855	hsa-miR-744-3p	HITS-CLIP	21572407
MIRT706854	hsa-miR-6885-3p	HITS-CLIP	21572407
MIRT706853	hsa-miR-5698	HITS-CLIP	21572407
MIRT1125336	hsa-miR-122	CLIP-seq
MIRT1125337	hsa-miR-1273f	CLIP-seq
MIRT1125338	hsa-miR-1275	CLIP-seq
MIRT1125339	hsa-miR-1290	CLIP-seq
MIRT1125340	hsa-miR-129-5p	CLIP-seq
MIRT1125341	hsa-miR-197	CLIP-seq
MIRT1125342	hsa-miR-198	CLIP-seq
MIRT1125343	hsa-miR-3126-5p	CLIP-seq
MIRT1125344	hsa-miR-3147	CLIP-seq
MIRT1125345	hsa-miR-3149	CLIP-seq
MIRT1125346	hsa-miR-3170	CLIP-seq
MIRT1125347	hsa-miR-3199	CLIP-seq
MIRT1125348	hsa-miR-3663-5p	CLIP-seq
MIRT1125349	hsa-miR-3672	CLIP-seq
MIRT1125350	hsa-miR-3674	CLIP-seq
MIRT1125351	hsa-miR-3690	CLIP-seq
MIRT1125352	hsa-miR-371-5p	CLIP-seq
MIRT1125353	hsa-miR-371b-5p	CLIP-seq
MIRT1125354	hsa-miR-378	CLIP-seq
MIRT1125355	hsa-miR-378b	CLIP-seq
MIRT1125356	hsa-miR-378c	CLIP-seq
MIRT1125357	hsa-miR-378d	CLIP-seq
MIRT1125358	hsa-miR-378e	CLIP-seq
MIRT1125359	hsa-miR-378f	CLIP-seq
MIRT1125360	hsa-miR-378g	CLIP-seq
MIRT1125361	hsa-miR-378h	CLIP-seq
MIRT1125362	hsa-miR-378i	CLIP-seq
MIRT1125363	hsa-miR-422a	CLIP-seq
MIRT1125364	hsa-miR-4254	CLIP-seq
MIRT1125365	hsa-miR-4329	CLIP-seq
MIRT1125366	hsa-miR-4425	CLIP-seq
MIRT1125367	hsa-miR-4463	CLIP-seq
MIRT1125368	hsa-miR-4525	CLIP-seq
MIRT1125369	hsa-miR-4645-5p	CLIP-seq
MIRT1125370	hsa-miR-4665-5p	CLIP-seq
MIRT1125371	hsa-miR-4673	CLIP-seq
MIRT1125372	hsa-miR-4716-5p	CLIP-seq
MIRT1125373	hsa-miR-4723-5p	CLIP-seq
MIRT1125374	hsa-miR-4728-5p	CLIP-seq
MIRT1125375	hsa-miR-4732-5p	CLIP-seq
MIRT1125376	hsa-miR-4740-5p	CLIP-seq
MIRT1125377	hsa-miR-5096	CLIP-seq
MIRT1125378	hsa-miR-625	CLIP-seq
MIRT2035366	hsa-miR-1224-3p	CLIP-seq
MIRT2035367	hsa-miR-1260	CLIP-seq
MIRT2035368	hsa-miR-1260b	CLIP-seq
MIRT2035369	hsa-miR-1280	CLIP-seq
MIRT2035370	hsa-miR-150	CLIP-seq
MIRT1125336	hsa-miR-122	CLIP-seq
MIRT2265859	hsa-miR-1245	CLIP-seq
MIRT1125337	hsa-miR-1273f	CLIP-seq
MIRT1125340	hsa-miR-129-5p	CLIP-seq
MIRT2265860	hsa-miR-1321	CLIP-seq
MIRT2035370	hsa-miR-150	CLIP-seq
MIRT1125341	hsa-miR-197	CLIP-seq
MIRT2265861	hsa-miR-1976	CLIP-seq
MIRT2265862	hsa-miR-2110	CLIP-seq
MIRT2265863	hsa-miR-3150a-3p	CLIP-seq
MIRT2265864	hsa-miR-3160-3p	CLIP-seq
MIRT1125346	hsa-miR-3170	CLIP-seq
MIRT2265865	hsa-miR-3175	CLIP-seq
MIRT1125347	hsa-miR-3199	CLIP-seq
MIRT1125350	hsa-miR-3674	CLIP-seq
MIRT1125352	hsa-miR-371-5p	CLIP-seq
MIRT2265866	hsa-miR-4260	CLIP-seq
MIRT2265867	hsa-miR-4270	CLIP-seq
MIRT2265868	hsa-miR-4300	CLIP-seq
MIRT2265869	hsa-miR-4419a	CLIP-seq
MIRT2265870	hsa-miR-4438	CLIP-seq
MIRT2265871	hsa-miR-4441	CLIP-seq
MIRT2265872	hsa-miR-4510	CLIP-seq
MIRT1125369	hsa-miR-4645-5p	CLIP-seq
MIRT2265873	hsa-miR-4649-3p	CLIP-seq
MIRT1125371	hsa-miR-4673	CLIP-seq
MIRT2265874	hsa-miR-4695-3p	CLIP-seq
MIRT2265875	hsa-miR-4720-3p	CLIP-seq
MIRT2265876	hsa-miR-4722-3p	CLIP-seq
MIRT1125374	hsa-miR-4728-5p	CLIP-seq
MIRT1125375	hsa-miR-4732-5p	CLIP-seq
MIRT2265877	hsa-miR-4739	CLIP-seq
MIRT2265878	hsa-miR-4743	CLIP-seq
MIRT2265879	hsa-miR-4756-5p	CLIP-seq
MIRT2265880	hsa-miR-5095	CLIP-seq
MIRT1125377	hsa-miR-5096	CLIP-seq
MIRT2265881	hsa-miR-532-3p	CLIP-seq
MIRT2265882	hsa-miR-562	CLIP-seq
MIRT2265883	hsa-miR-675	CLIP-seq
MIRT2265884	hsa-miR-920	CLIP-seq
MIRT2265885	hsa-miR-939	CLIP-seq
MIRT2390450	hsa-miR-4287	CLIP-seq
MIRT2390451	hsa-miR-4469	CLIP-seq
MIRT2390452	hsa-miR-4685-3p	CLIP-seq
MIRT2390453	hsa-miR-4768-5p	CLIP-seq
MIRT2390454	hsa-miR-597	CLIP-seq
MIRT2390455	hsa-miR-942	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	NAS	27052415, 33897412
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	12490281
GO:0001701	Process	In utero embryonic development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	8932385, 23661758, 26496610, 28514442, 32911434, 33961781, 34591642
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	23661758
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005739	Component	Mitochondrion	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	23661758
GO:0007567	Process	Parturition	TAS	10527846
GO:0035914	Process	Skeletal muscle cell differentiation	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	23332764
GO:0045604	Process	Regulation of epidermal cell differentiation	IBA
GO:0045604	Process	Regulation of epidermal cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12490281
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	23661758
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
604877	6780	ENSG00000185022

Q9ULX9

Protein name

Transcription factor MafF (U-Maf) (V-maf musculoaponeurotic fibrosarcoma oncogene homolog F)

Protein function

Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves (PubMed:8932385). However, they seem to serve as transcriptional activators by dimerizing with other (usua

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03131	bZIP_Maf	24 → 115	bZIP Maf transcription factor	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Expressed in the term myometrium and kidney.

Sequence

MSVDPLSSKALKIKRELSENTPHLSDEALMGLSVRELNRHLRGLSAEEVTRLKQRRRTLK
NRGYAASCRVKRVCQKEELQKQKSELEREVDKLARENAAMRLELDALRGKCEALQGFARS
VAAARGPATLVAPASVITIVKSTPGSGSGPAHGPDPAHGPASCS

Sequence length

164

Interactions

View interactions

	Reactome
			Factors involved in megakaryocyte development and platelet production

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARTHRITIS, JUVENILE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BENIGN NEOPLASM OF SKIN	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOCYTIC NEVUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE PROLAPSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (24)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	34151731	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29757260	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31969212	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	28713898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	33980595	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive Nephropathy	Hypertensive nephropathy	Pubtator	28713898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	28984203	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29757260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	29703138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23291271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	23291271, 36423637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	23291271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	29695719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	24118457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	GWASDB_DG	19578365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37283761	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28222515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33315534	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	25908172	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MAFF (MAF bZIP transcription factor F)