Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23759
Gene name	Peptidylprolyl isomerase like 2
Gene symbol	PPIL2
Synonyms (NCBI Gene)	CYC4CYP60Cyp-60UBOX7hCyP-60
Chromosome	22
Chromosome location	22q11.21-q11.22
Summary	This gene is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1

191

Show/Hide all (191)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049857	hsa-miR-31-5p	CLASH	23622248
MIRT046489	hsa-miR-15b-5p	CLASH	23622248
MIRT639221	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT639220	hsa-miR-6507-5p	HITS-CLIP	23824327
MIRT639219	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT639218	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT639217	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT639216	hsa-miR-8063	HITS-CLIP	23824327
MIRT639215	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT639214	hsa-miR-4775	HITS-CLIP	23824327
MIRT639221	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT639220	hsa-miR-6507-5p	HITS-CLIP	23824327
MIRT639219	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT639218	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT639217	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT639216	hsa-miR-8063	HITS-CLIP	23824327
MIRT639215	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT639214	hsa-miR-4775	HITS-CLIP	23824327
MIRT1253124	hsa-miR-1229	CLIP-seq
MIRT1253125	hsa-miR-15a	CLIP-seq
MIRT1253126	hsa-miR-15b	CLIP-seq
MIRT1253127	hsa-miR-16	CLIP-seq
MIRT1253128	hsa-miR-1908	CLIP-seq
MIRT1253129	hsa-miR-193a-3p	CLIP-seq
MIRT1253130	hsa-miR-193b	CLIP-seq
MIRT1253131	hsa-miR-195	CLIP-seq
MIRT1253132	hsa-miR-2117	CLIP-seq
MIRT1253133	hsa-miR-214	CLIP-seq
MIRT1253134	hsa-miR-2278	CLIP-seq
MIRT1253135	hsa-miR-2861	CLIP-seq
MIRT1253136	hsa-miR-3126-5p	CLIP-seq
MIRT1253137	hsa-miR-3130-5p	CLIP-seq
MIRT1253138	hsa-miR-3141	CLIP-seq
MIRT1253139	hsa-miR-3175	CLIP-seq
MIRT1253140	hsa-miR-3176	CLIP-seq
MIRT1253141	hsa-miR-342-3p	CLIP-seq
MIRT1253142	hsa-miR-3619-5p	CLIP-seq
MIRT1253143	hsa-miR-3677-5p	CLIP-seq
MIRT1253144	hsa-miR-3922-3p	CLIP-seq
MIRT1253145	hsa-miR-3922-5p	CLIP-seq
MIRT1253146	hsa-miR-424	CLIP-seq
MIRT1253147	hsa-miR-4273	CLIP-seq
MIRT1253148	hsa-miR-4291	CLIP-seq
MIRT1253149	hsa-miR-432	CLIP-seq
MIRT1253150	hsa-miR-4324	CLIP-seq
MIRT1253151	hsa-miR-4436b-5p	CLIP-seq
MIRT1253152	hsa-miR-4459	CLIP-seq
MIRT1253153	hsa-miR-4468	CLIP-seq
MIRT1253154	hsa-miR-4482	CLIP-seq
MIRT1253155	hsa-miR-4677-5p	CLIP-seq
MIRT1253156	hsa-miR-4706	CLIP-seq
MIRT1253157	hsa-miR-4708-3p	CLIP-seq
MIRT1253158	hsa-miR-4717-5p	CLIP-seq
MIRT1253159	hsa-miR-4722-5p	CLIP-seq
MIRT1253160	hsa-miR-4743	CLIP-seq
MIRT1253161	hsa-miR-4749-5p	CLIP-seq
MIRT1253162	hsa-miR-4753-5p	CLIP-seq
MIRT1253163	hsa-miR-4757-5p	CLIP-seq
MIRT1253164	hsa-miR-4768-3p	CLIP-seq
MIRT1253165	hsa-miR-4779	CLIP-seq
MIRT1253166	hsa-miR-497	CLIP-seq
MIRT1253167	hsa-miR-663	CLIP-seq
MIRT1253168	hsa-miR-761	CLIP-seq
MIRT1253169	hsa-miR-765	CLIP-seq
MIRT1253170	hsa-miR-922	CLIP-seq
MIRT1253171	hsa-miR-924	CLIP-seq
MIRT1253172	hsa-miR-10a	CLIP-seq
MIRT1253173	hsa-miR-10b	CLIP-seq
MIRT1253174	hsa-miR-1184	CLIP-seq
MIRT1253175	hsa-miR-1193	CLIP-seq
MIRT1253176	hsa-miR-1208	CLIP-seq
MIRT1253177	hsa-miR-1272	CLIP-seq
MIRT1253178	hsa-miR-1275	CLIP-seq
MIRT1253179	hsa-miR-1285	CLIP-seq
MIRT1253180	hsa-miR-1301	CLIP-seq
MIRT1253181	hsa-miR-1972	CLIP-seq
MIRT1253182	hsa-miR-205	CLIP-seq
MIRT1253183	hsa-miR-2116	CLIP-seq
MIRT1253184	hsa-miR-24	CLIP-seq
MIRT1253185	hsa-miR-2467-3p	CLIP-seq
MIRT1253186	hsa-miR-30a	CLIP-seq
MIRT1253187	hsa-miR-30b	CLIP-seq
MIRT1253188	hsa-miR-30c	CLIP-seq
MIRT1253189	hsa-miR-30d	CLIP-seq
MIRT1253190	hsa-miR-30e	CLIP-seq
MIRT1253191	hsa-miR-3123	CLIP-seq
MIRT1253192	hsa-miR-3138	CLIP-seq
MIRT1253193	hsa-miR-3179	CLIP-seq
MIRT1253194	hsa-miR-3187-5p	CLIP-seq
MIRT1253195	hsa-miR-3194-5p	CLIP-seq
MIRT1253196	hsa-miR-3202	CLIP-seq
MIRT1253197	hsa-miR-34a	CLIP-seq
MIRT1253198	hsa-miR-34c-5p	CLIP-seq
MIRT1253199	hsa-miR-3657	CLIP-seq
MIRT1253200	hsa-miR-3681	CLIP-seq
MIRT1253201	hsa-miR-3688-5p	CLIP-seq
MIRT1253202	hsa-miR-3691-5p	CLIP-seq
MIRT1253203	hsa-miR-3919	CLIP-seq
MIRT1253204	hsa-miR-4257	CLIP-seq
MIRT1253205	hsa-miR-4276	CLIP-seq
MIRT1253206	hsa-miR-4286	CLIP-seq
MIRT1253148	hsa-miR-4291	CLIP-seq
MIRT1253207	hsa-miR-4310	CLIP-seq
MIRT1253208	hsa-miR-4435	CLIP-seq
MIRT1253209	hsa-miR-4436b-3p	CLIP-seq
MIRT1253210	hsa-miR-4437	CLIP-seq
MIRT1253211	hsa-miR-4476	CLIP-seq
MIRT1253212	hsa-miR-4495	CLIP-seq
MIRT1253213	hsa-miR-449a	CLIP-seq
MIRT1253214	hsa-miR-449b	CLIP-seq
MIRT1253215	hsa-miR-4525	CLIP-seq
MIRT1253216	hsa-miR-4650-5p	CLIP-seq
MIRT1253217	hsa-miR-4652-5p	CLIP-seq
MIRT1253218	hsa-miR-4660	CLIP-seq
MIRT1253219	hsa-miR-4665-5p	CLIP-seq
MIRT1253220	hsa-miR-4669	CLIP-seq
MIRT1253155	hsa-miR-4677-5p	CLIP-seq
MIRT1253221	hsa-miR-4704-3p	CLIP-seq
MIRT1253222	hsa-miR-4711-5p	CLIP-seq
MIRT1253223	hsa-miR-4723-5p	CLIP-seq
MIRT1253224	hsa-miR-486-5p	CLIP-seq
MIRT1253225	hsa-miR-5047	CLIP-seq
MIRT1253226	hsa-miR-539	CLIP-seq
MIRT1253227	hsa-miR-579	CLIP-seq
MIRT1253228	hsa-miR-596	CLIP-seq
MIRT1253229	hsa-miR-612	CLIP-seq
MIRT1253230	hsa-miR-625	CLIP-seq
MIRT1253231	hsa-miR-652	CLIP-seq
MIRT1253232	hsa-miR-663b	CLIP-seq
MIRT1253233	hsa-miR-892a	CLIP-seq
MIRT2074643	hsa-miR-1587	CLIP-seq
MIRT2074644	hsa-miR-224	CLIP-seq
MIRT1253185	hsa-miR-2467-3p	CLIP-seq
MIRT2074645	hsa-miR-3158-5p	CLIP-seq
MIRT2074646	hsa-miR-3652	CLIP-seq
MIRT2074647	hsa-miR-3678-3p	CLIP-seq
MIRT2074648	hsa-miR-4292	CLIP-seq
MIRT2074649	hsa-miR-4430	CLIP-seq
MIRT2074650	hsa-miR-4438	CLIP-seq
MIRT2074651	hsa-miR-4492	CLIP-seq
MIRT2074652	hsa-miR-4498	CLIP-seq
MIRT2074653	hsa-miR-4656	CLIP-seq
MIRT2074654	hsa-miR-4675	CLIP-seq
MIRT2074655	hsa-miR-4741	CLIP-seq
MIRT2074656	hsa-miR-762	CLIP-seq
MIRT1253185	hsa-miR-2467-3p	CLIP-seq
MIRT2074654	hsa-miR-4675	CLIP-seq
MIRT1253221	hsa-miR-4704-3p	CLIP-seq
MIRT2074655	hsa-miR-4741	CLIP-seq
MIRT1253205	hsa-miR-4276	CLIP-seq
MIRT1253148	hsa-miR-4291	CLIP-seq
MIRT1253207	hsa-miR-4310	CLIP-seq
MIRT1253222	hsa-miR-4711-5p	CLIP-seq
MIRT2598221	hsa-miR-1286	CLIP-seq
MIRT2598222	hsa-miR-1288	CLIP-seq
MIRT2598223	hsa-miR-129-3p	CLIP-seq
MIRT2598224	hsa-miR-1294	CLIP-seq
MIRT2598225	hsa-miR-133a	CLIP-seq
MIRT2598226	hsa-miR-133b	CLIP-seq
MIRT2598227	hsa-miR-2276	CLIP-seq
MIRT2598228	hsa-miR-299-5p	CLIP-seq
MIRT2598229	hsa-miR-3169	CLIP-seq
MIRT1253140	hsa-miR-3176	CLIP-seq
MIRT1253195	hsa-miR-3194-5p	CLIP-seq
MIRT2598230	hsa-miR-331-3p	CLIP-seq
MIRT2598231	hsa-miR-339-5p	CLIP-seq
MIRT2598232	hsa-miR-3670	CLIP-seq
MIRT2598233	hsa-miR-3909	CLIP-seq
MIRT1253144	hsa-miR-3922-3p	CLIP-seq
MIRT2598234	hsa-miR-4316	CLIP-seq
MIRT2598235	hsa-miR-4420	CLIP-seq
MIRT2598236	hsa-miR-4701-5p	CLIP-seq
MIRT1253157	hsa-miR-4708-3p	CLIP-seq
MIRT2598237	hsa-miR-520d-5p	CLIP-seq
MIRT2598238	hsa-miR-524-5p	CLIP-seq
MIRT2598239	hsa-miR-588	CLIP-seq
MIRT2688438	hsa-miR-125a-3p	CLIP-seq
MIRT2598221	hsa-miR-1286	CLIP-seq
MIRT2598222	hsa-miR-1288	CLIP-seq
MIRT2688439	hsa-miR-1291	CLIP-seq
MIRT2598227	hsa-miR-2276	CLIP-seq
MIRT1253134	hsa-miR-2278	CLIP-seq
MIRT2598229	hsa-miR-3169	CLIP-seq
MIRT2688440	hsa-miR-3665	CLIP-seq
MIRT2688441	hsa-miR-3918	CLIP-seq
MIRT2598235	hsa-miR-4420	CLIP-seq
MIRT1253152	hsa-miR-4459	CLIP-seq
MIRT1253153	hsa-miR-4468	CLIP-seq
MIRT1253157	hsa-miR-4708-3p	CLIP-seq
MIRT1253159	hsa-miR-4722-5p	CLIP-seq
MIRT2688442	hsa-miR-4792	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IDA	11435423
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	IDA	20676357
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0005515	Function	Protein binding	IPI	15946952, 22365833, 25416956, 33961781
GO:0005634	Component	Nucleus	IDA	11435423, 15946952
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	8660300
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005681	Component	Spliceosomal complex	IEA
GO:0005737	Component	Cytoplasm	IDA	15946952
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	IDA	15946952
GO:0006397	Process	MRNA processing	IEA
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IEA
GO:0008380	Process	RNA splicing	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0034450	Function	Ubiquitin-ubiquitin ligase activity	IDA	11435423
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	11435423
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0071013	Component	Catalytic step 2 spliceosome	IBA
GO:0072659	Process	Protein localization to plasma membrane	IMP	15946952

MIM	HGNC	e!Ensembl
607588	9261	ENSG00000100023

Q13356

Protein name

RING-type E3 ubiquitin-protein ligase PPIL2 (EC 2.3.2.27) (CYC4) (Cyclophilin-60) (Cyclophilin-like protein Cyp-60) (Cyp60) (hCyP-60) (Probable inactive peptidyl-prolyl cis-trans isomerase-like 2) (PPIase) (Rotamase PPIL2)

Protein function

Has a ubiquitin-protein ligase activity acting as an E3 ubiquitin protein ligase or as an ubiquitin-ubiquitin ligase promoting elongation of ubiquitin chains on substrates. By mediating 'Lys-48'-linked polyubiquitination of proteins could target

PDB

1ZKC , 7ABI , 7DVQ , 7QTT , 8CH6 , 8I0P , 8I0R , 8I0S , 8I0T

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00160	Pro_isomerase	281 → 433	Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD	Domain

Tissue specificity

TISSUE SPECIFICITY: Highest expression in thymus, pancreas and testis. Also detected in heart, placenta, lung, liver, skeletal muscle, kidney, spleen, prostate, ovary, small intestine and colon. Poorly detected in brain and leukocytes. Strong protein expr

Sequence

MGKRQHQKDKMYITCAEYTHFYGGKKPDLPQTNFRRLPFDHCSLSLQPFVYPVCTPDGIV
FDLLNIVPWLKKYGTNPSNGEKLDGRSLIKLNFSKNSEGKYHCPVLFTVFTNNTHIVAVR
TTGNVYAYEAVEQLNIKAKNFRDLLTDEPFSRQDIITLQDPTNLDKFNVSNFYHVKNNMK
IIDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKAPEKKKVDKLNAAH
YSTGKVSASFTSTAMVPETTHEAAAIDEDVLRYQFVKKKGYVRLHTNKGDLNLELHCDLT
PKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLSH
TGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKTD
RPKEEIRIDATTVFVDPYEEADAQIAQERKTQLKVAPETKVKSSQPQAGSQGPQTFRQGV
GKYINPAATKRAAEEEPSTSATVPMSKKKPSRGFGDFSSW

Sequence length

520

Interactions

View interactions

	KEGG		Reactome
	Ubiquitin mediated proteolysis		Basigin interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	28011744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15946952	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29352246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29352246	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	29990590	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29310926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29352246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29352246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31830361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach Diseases	BEFREE	29148176		★★★★★ ★☆☆☆☆ Found in Text Mining only

PPIL2 (peptidylprolyl isomerase like 2)