Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	23753
Gene name	Stromal cell derived factor 2 like 1
Gene symbol	SDF2L1
Synonyms (NCBI Gene)	-
Chromosome	22
Chromosome location	22q11.21

Show/Hide all (41)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018061	hsa-miR-335-5p	Microarray	18185580
MIRT022774	hsa-miR-124-3p	Microarray	18668037
MIRT047950	hsa-miR-30c-5p	CLASH	23622248
MIRT1331686	hsa-miR-1224-3p	CLIP-seq
MIRT1331687	hsa-miR-1224-5p	CLIP-seq
MIRT1331688	hsa-miR-124	CLIP-seq
MIRT1331689	hsa-miR-1283	CLIP-seq
MIRT1331690	hsa-miR-1291	CLIP-seq
MIRT1331691	hsa-miR-3158-5p	CLIP-seq
MIRT1331692	hsa-miR-3166	CLIP-seq
MIRT1331693	hsa-miR-3173-5p	CLIP-seq
MIRT1331694	hsa-miR-328	CLIP-seq
MIRT1331695	hsa-miR-34b	CLIP-seq
MIRT1331696	hsa-miR-3677-5p	CLIP-seq
MIRT1331697	hsa-miR-3915	CLIP-seq
MIRT1331698	hsa-miR-4480	CLIP-seq
MIRT1331699	hsa-miR-4689	CLIP-seq
MIRT1331700	hsa-miR-4715-3p	CLIP-seq
MIRT1331701	hsa-miR-4719	CLIP-seq
MIRT1331702	hsa-miR-4722-3p	CLIP-seq
MIRT1331703	hsa-miR-4727-5p	CLIP-seq
MIRT1331704	hsa-miR-4751	CLIP-seq
MIRT1331705	hsa-miR-4758-3p	CLIP-seq
MIRT1331706	hsa-miR-4769-3p	CLIP-seq
MIRT1331707	hsa-miR-4771	CLIP-seq
MIRT1331708	hsa-miR-506	CLIP-seq
MIRT1331709	hsa-miR-543	CLIP-seq
MIRT1331710	hsa-miR-548an	CLIP-seq
MIRT1331711	hsa-miR-593	CLIP-seq
MIRT1331712	hsa-miR-663b	CLIP-seq
MIRT1331700	hsa-miR-4715-3p	CLIP-seq
MIRT1331687	hsa-miR-1224-5p	CLIP-seq
MIRT1331688	hsa-miR-124	CLIP-seq
MIRT1331689	hsa-miR-1283	CLIP-seq
MIRT1331695	hsa-miR-34b	CLIP-seq
MIRT1331697	hsa-miR-3915	CLIP-seq
MIRT1331699	hsa-miR-4689	CLIP-seq
MIRT1331701	hsa-miR-4719	CLIP-seq
MIRT1331704	hsa-miR-4751	CLIP-seq
MIRT1331708	hsa-miR-506	CLIP-seq
MIRT1331710	hsa-miR-548an	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005783	Component	Endoplasmic reticulum	IDA	28597544
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	IEA
GO:0016020	Component	Membrane	IEA
GO:0034663	Component	Endoplasmic reticulum chaperone complex	IEA
GO:0034976	Process	Response to endoplasmic reticulum stress	IEA
GO:0036503	Process	ERAD pathway	IEA
GO:0042026	Process	Protein refolding	IMP	28597544
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0051087	Function	Protein-folding chaperone binding	IEA
GO:0051117	Function	ATPase binding	IEA
GO:0051787	Function	Misfolded protein binding	IDA	28597544
GO:0051787	Function	Misfolded protein binding	IEA
GO:0071218	Process	Cellular response to misfolded protein	IEA
GO:0101031	Component	Protein folding chaperone complex	IEA
GO:0101031	Component	Protein folding chaperone complex	IPI	28597544

MIM	HGNC	e!Ensembl
607551	10676	ENSG00000128228

Q9HCN8

Protein name

Stromal cell-derived factor 2-like protein 1 (SDF2-like protein 1) (PWP1-interacting protein 8)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02815	MIR	43 → 177	MIR domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed with high expression in testis, moderate expression in the pancreas, spleen, prostate, small intestine and colon. Very low expression is seen in brain and skeletal muscle. {ECO:0000269|PubMed:11162531}.

Sequence

MWSAGRGGAAWPVLLGLLLALLVPGGGAAKTGAELVTCGSVLKLLNTHHRVRLHSHDIKY
GSGSGQQSVTGVEASDDANSYWRIRGGSEGGCPRGSPVRCGQAVRLTHVLTGKNLHTHHF
PSPLSNNQEVSAFGEDGEGDDLDLWTVRCSGQHWEREAAVRFQHVGTSVFLSVTGEQYGS
PIRGQHEVHGMPSANTHNTWKAMEGIFIKPSVEPSAGHDEL

Sequence length

221

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	19513569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	30814508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17013881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	33134371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17013881		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	30891314		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	12679234, 20414250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30814508		★★★★★ ★☆☆☆☆ Found in Text Mining only

SDF2L1 (stromal cell derived factor 2 like 1)