Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23705
Gene name	Cell adhesion molecule 1
Gene symbol	CADM1
Synonyms (NCBI Gene)	BL2IGSF4IGSF4ANECL2Necl-2RA175ST17SYNCAMTSLC1sTSLC-1sgIGSFsynCAM1
Chromosome	11
Chromosome location	11q23.3

200

Show/Hide all (200)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003888	hsa-miR-15a-5p	Reporter assayqRT-PCR	18362358
MIRT004382	hsa-miR-16-5p	Reporter assayqRT-PCR	18362358
MIRT004167	hsa-miR-192-5p	Microarray	16822819
MIRT029576	hsa-miR-26b-5p	Microarray	19088304
MIRT042379	hsa-miR-484	CLASH	23622248
MIRT036901	hsa-miR-877-3p	CLASH	23622248
MIRT054846	hsa-miR-182-5p	Luciferase reporter assayqRT-PCRWestern blot	24445397
MIRT438847	hsa-miR-486-5p	qRT-PCR	23294929
MIRT438815	hsa-miR-214-3p	Luciferase reporter assay	23301758
MIRT438847	hsa-miR-486-5p	qRT-PCR	23294929
MIRT438815	hsa-miR-214-3p	Luciferase reporter assay	23301758
MIRT708158	hsa-miR-7161-3p	HITS-CLIP	21572407
MIRT708157	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT708156	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT708155	hsa-miR-6083	HITS-CLIP	21572407
MIRT708154	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT574844	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT438847	hsa-miR-486-5p	PAR-CLIP	20371350
MIRT574848	hsa-miR-10a-5p	PAR-CLIP	20371350
MIRT574847	hsa-miR-10b-5p	PAR-CLIP	20371350
MIRT574846	hsa-miR-652-5p	PAR-CLIP	20371350
MIRT574845	hsa-miR-6732-3p	PAR-CLIP	20371350
MIRT574844	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT574843	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT574842	hsa-miR-7852-3p	PAR-CLIP	20371350
MIRT574841	hsa-miR-140-3p	PAR-CLIP	20371350
MIRT574840	hsa-miR-4703-3p	PAR-CLIP	20371350
MIRT058253	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT058254	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT574839	hsa-miR-3692-3p	PAR-CLIP	20371350
MIRT538752	hsa-miR-548an	PAR-CLIP	22012620
MIRT538751	hsa-miR-6768-3p	PAR-CLIP	22012620
MIRT538750	hsa-miR-4484	PAR-CLIP	22012620
MIRT538749	hsa-miR-4475	PAR-CLIP	22012620
MIRT538748	hsa-miR-6512-5p	PAR-CLIP	22012620
MIRT538747	hsa-miR-4327	PAR-CLIP	22012620
MIRT538746	hsa-miR-6892-5p	PAR-CLIP	22012620
MIRT538745	hsa-miR-1273e	PAR-CLIP	22012620
MIRT538744	hsa-miR-6885-3p	PAR-CLIP	22012620
MIRT494397	hsa-miR-4428	PAR-CLIP	23592263
MIRT494396	hsa-miR-361-3p	PAR-CLIP	23592263
MIRT494395	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT494394	hsa-miR-4479	PAR-CLIP	23592263
MIRT494393	hsa-miR-185-5p	PAR-CLIP	23592263
MIRT494392	hsa-miR-4306	PAR-CLIP	23592263
MIRT494391	hsa-miR-4644	PAR-CLIP	23592263
MIRT732065	hsa-miR-126-3p	Luciferase reporter assayqRT-PCRWestern blot	26464628
MIRT732065	hsa-miR-126-3p	Luciferase reporter assayqRT-PCRWestern blot	26464628
MIRT736208	hsa-miR-25-3p	Microarray	31919459
MIRT737429	hsa-miR-424-5p	Western blottingMicroarray	31819525
MIRT708158	hsa-miR-7161-3p	HITS-CLIP	21572407
MIRT708157	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT708156	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT708155	hsa-miR-6083	HITS-CLIP	21572407
MIRT708154	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT574844	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT438847	hsa-miR-486-5p	PAR-CLIP	20371350
MIRT574848	hsa-miR-10a-5p	PAR-CLIP	20371350
MIRT574847	hsa-miR-10b-5p	PAR-CLIP	20371350
MIRT574846	hsa-miR-652-5p	PAR-CLIP	20371350
MIRT574845	hsa-miR-6732-3p	PAR-CLIP	20371350
MIRT574844	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT574843	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT574842	hsa-miR-7852-3p	PAR-CLIP	20371350
MIRT574841	hsa-miR-140-3p	PAR-CLIP	20371350
MIRT574840	hsa-miR-4703-3p	PAR-CLIP	20371350
MIRT058253	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT058254	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT574839	hsa-miR-3692-3p	PAR-CLIP	20371350
MIRT538752	hsa-miR-548an	PAR-CLIP	22012620
MIRT538751	hsa-miR-6768-3p	PAR-CLIP	22012620
MIRT538750	hsa-miR-4484	PAR-CLIP	22012620
MIRT538749	hsa-miR-4475	PAR-CLIP	22012620
MIRT538748	hsa-miR-6512-5p	PAR-CLIP	22012620
MIRT538747	hsa-miR-4327	PAR-CLIP	22012620
MIRT538746	hsa-miR-6892-5p	PAR-CLIP	22012620
MIRT538745	hsa-miR-1273e	PAR-CLIP	22012620
MIRT538744	hsa-miR-6885-3p	PAR-CLIP	22012620
MIRT494397	hsa-miR-4428	PAR-CLIP	23592263
MIRT494396	hsa-miR-361-3p	PAR-CLIP	23592263
MIRT494395	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT494394	hsa-miR-4479	PAR-CLIP	23592263
MIRT494393	hsa-miR-185-5p	PAR-CLIP	23592263
MIRT494392	hsa-miR-4306	PAR-CLIP	23592263
MIRT494391	hsa-miR-4644	PAR-CLIP	23592263
MIRT858452	hsa-miR-101	CLIP-seq
MIRT858453	hsa-miR-124	CLIP-seq
MIRT858454	hsa-miR-1279	CLIP-seq
MIRT858455	hsa-miR-144	CLIP-seq
MIRT858456	hsa-miR-15a	CLIP-seq
MIRT858457	hsa-miR-15b	CLIP-seq
MIRT858458	hsa-miR-16	CLIP-seq
MIRT858459	hsa-miR-193a-3p	CLIP-seq
MIRT858460	hsa-miR-193b	CLIP-seq
MIRT858461	hsa-miR-194	CLIP-seq
MIRT858462	hsa-miR-195	CLIP-seq
MIRT858463	hsa-miR-1972	CLIP-seq
MIRT858464	hsa-miR-2052	CLIP-seq
MIRT858465	hsa-miR-2054	CLIP-seq
MIRT858466	hsa-miR-23a	CLIP-seq
MIRT858467	hsa-miR-23b	CLIP-seq
MIRT858468	hsa-miR-23c	CLIP-seq
MIRT858469	hsa-miR-25	CLIP-seq
MIRT858470	hsa-miR-3065-5p	CLIP-seq
MIRT858471	hsa-miR-3143	CLIP-seq
MIRT858472	hsa-miR-3176	CLIP-seq
MIRT858473	hsa-miR-32	CLIP-seq
MIRT858474	hsa-miR-3607-3p	CLIP-seq
MIRT858475	hsa-miR-3613-3p	CLIP-seq
MIRT858476	hsa-miR-363	CLIP-seq
MIRT858477	hsa-miR-367	CLIP-seq
MIRT858478	hsa-miR-3686	CLIP-seq
MIRT858479	hsa-miR-375	CLIP-seq
MIRT858480	hsa-miR-3922-3p	CLIP-seq
MIRT858481	hsa-miR-424	CLIP-seq
MIRT858482	hsa-miR-4289	CLIP-seq
MIRT858483	hsa-miR-4329	CLIP-seq
MIRT858484	hsa-miR-4668-5p	CLIP-seq
MIRT858485	hsa-miR-4716-3p	CLIP-seq
MIRT858486	hsa-miR-4716-5p	CLIP-seq
MIRT858487	hsa-miR-4717-5p	CLIP-seq
MIRT858488	hsa-miR-4762-5p	CLIP-seq
MIRT858489	hsa-miR-494	CLIP-seq
MIRT858490	hsa-miR-495	CLIP-seq
MIRT858491	hsa-miR-497	CLIP-seq
MIRT858492	hsa-miR-505	CLIP-seq
MIRT858493	hsa-miR-506	CLIP-seq
MIRT858494	hsa-miR-543	CLIP-seq
MIRT858495	hsa-miR-545	CLIP-seq
MIRT858496	hsa-miR-548ac	CLIP-seq
MIRT858497	hsa-miR-548ae	CLIP-seq
MIRT858498	hsa-miR-548aj	CLIP-seq
MIRT858499	hsa-miR-548am	CLIP-seq
MIRT858500	hsa-miR-548d-3p	CLIP-seq
MIRT858501	hsa-miR-548x	CLIP-seq
MIRT858502	hsa-miR-548z	CLIP-seq
MIRT858503	hsa-miR-577	CLIP-seq
MIRT858504	hsa-miR-600	CLIP-seq
MIRT858505	hsa-miR-625	CLIP-seq
MIRT858506	hsa-miR-92a	CLIP-seq
MIRT858507	hsa-miR-92b	CLIP-seq
MIRT858452	hsa-miR-101	CLIP-seq
MIRT858463	hsa-miR-1972	CLIP-seq
MIRT858508	hsa-miR-214	CLIP-seq
MIRT858509	hsa-miR-219-1-3p	CLIP-seq
MIRT858510	hsa-miR-3117-5p	CLIP-seq
MIRT858511	hsa-miR-3129-3p	CLIP-seq
MIRT858512	hsa-miR-3148	CLIP-seq
MIRT858513	hsa-miR-3619-5p	CLIP-seq
MIRT858514	hsa-miR-3667-3p	CLIP-seq
MIRT858515	hsa-miR-3679-3p	CLIP-seq
MIRT858516	hsa-miR-4297	CLIP-seq
MIRT858517	hsa-miR-4446-5p	CLIP-seq
MIRT858518	hsa-miR-4690-5p	CLIP-seq
MIRT858519	hsa-miR-4698	CLIP-seq
MIRT858487	hsa-miR-4717-5p	CLIP-seq
MIRT858520	hsa-miR-4742-5p	CLIP-seq
MIRT858521	hsa-miR-514	CLIP-seq
MIRT858522	hsa-miR-514b-3p	CLIP-seq
MIRT858523	hsa-miR-761	CLIP-seq
MIRT858452	hsa-miR-101	CLIP-seq
MIRT1954945	hsa-miR-10a	CLIP-seq
MIRT1954946	hsa-miR-10b	CLIP-seq
MIRT1954947	hsa-miR-1228	CLIP-seq
MIRT1954948	hsa-miR-1252	CLIP-seq
MIRT858455	hsa-miR-144	CLIP-seq
MIRT858461	hsa-miR-194	CLIP-seq
MIRT1954949	hsa-miR-205	CLIP-seq
MIRT1954950	hsa-miR-2116	CLIP-seq
MIRT1954951	hsa-miR-329	CLIP-seq
MIRT1954952	hsa-miR-3614-5p	CLIP-seq
MIRT1954953	hsa-miR-362-3p	CLIP-seq
MIRT1954954	hsa-miR-3678-3p	CLIP-seq
MIRT1954955	hsa-miR-3692	CLIP-seq
MIRT858488	hsa-miR-4762-5p	CLIP-seq
MIRT1954956	hsa-miR-561	CLIP-seq
MIRT1954957	hsa-miR-759	CLIP-seq
MIRT2192532	hsa-miR-1271	CLIP-seq
MIRT2192533	hsa-miR-139-3p	CLIP-seq
MIRT2192534	hsa-miR-182	CLIP-seq
MIRT1954955	hsa-miR-3692	CLIP-seq
MIRT2192535	hsa-miR-412	CLIP-seq
MIRT2192536	hsa-miR-4324	CLIP-seq
MIRT858483	hsa-miR-4329	CLIP-seq
MIRT2192537	hsa-miR-4420	CLIP-seq
MIRT2192538	hsa-miR-4476	CLIP-seq
MIRT2192539	hsa-miR-450b-5p	CLIP-seq
MIRT858488	hsa-miR-4762-5p	CLIP-seq
MIRT858492	hsa-miR-505	CLIP-seq
MIRT2192540	hsa-miR-570	CLIP-seq
MIRT2192541	hsa-miR-96	CLIP-seq
MIRT2495770	hsa-miR-1305	CLIP-seq
MIRT2495771	hsa-miR-1323	CLIP-seq
MIRT2495772	hsa-miR-3689a-3p	CLIP-seq
MIRT2495773	hsa-miR-3689c	CLIP-seq
MIRT2495774	hsa-miR-4426	CLIP-seq
MIRT2495775	hsa-miR-4647	CLIP-seq
MIRT2495776	hsa-miR-4662b	CLIP-seq
MIRT2495777	hsa-miR-4728-5p	CLIP-seq
MIRT2495778	hsa-miR-548o	CLIP-seq

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001819	Process	Positive regulation of cytokine production	IDA	15811952
GO:0001913	Process	T cell mediated cytotoxicity	IDA	15811952
GO:0002376	Process	Immune system process	IEA
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005102	Function	Signaling receptor binding	IPI	15811952
GO:0005102	Function	Signaling receptor binding	ISS	12826663
GO:0005515	Function	Protein binding	IPI	12234973, 20479255, 23871486, 24503895, 25416956, 29099056
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	15811952
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005911	Component	Cell-cell junction	ISS	12826663
GO:0006915	Process	Apoptotic process	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IBA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	ISS	12826663
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	ISS	12826663
GO:0007283	Process	Spermatogenesis	IEA
GO:0008037	Process	Cell recognition	IBA
GO:0008037	Process	Cell recognition	IDA	15811952
GO:0008037	Process	Cell recognition	ISS	12826663
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	ISS	12826663
GO:0030154	Process	Cell differentiation	IEA
GO:0030165	Function	PDZ domain binding	ISS	12826663
GO:0042271	Process	Susceptibility to natural killer cell mediated cytotoxicity	IBA
GO:0042271	Process	Susceptibility to natural killer cell mediated cytotoxicity	IDA	15811952
GO:0042271	Process	Susceptibility to natural killer cell mediated cytotoxicity	ISS	12826663
GO:0042803	Function	Protein homodimerization activity	ISS	12826663
GO:0043005	Component	Neuron projection	IBA
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IDA	15811952
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	ISS	12826663
GO:0050798	Process	Activated T cell proliferation	IDA	15811952
GO:0051606	Process	Detection of stimulus	IBA
GO:0051606	Process	Detection of stimulus	IDA	15811952
GO:0051606	Process	Detection of stimulus	ISS	12826663

MIM	HGNC	e!Ensembl
605686	5951	ENSG00000182985

Q9BY67

Protein name

Cell adhesion molecule 1 (Immunoglobulin superfamily member 4) (IgSF4) (Nectin-like protein 2) (NECL-2) (Spermatogenic immunoglobulin superfamily) (SgIgSF) (Synaptic cell adhesion molecule) (SynCAM) (Tumor suppressor in lung cancer 1) (TSLC-1)

Protein function

Mediates homophilic cell-cell adhesion in a Ca(2+)-independent manner (PubMed:12050160, PubMed:22438059). Also mediates heterophilic cell-cell adhesion with CADM3 and NECTIN3 in a Ca(2+)-independent manner (By similarity). Interaction with CRTAM

PDB

3BIN , 4H5S

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	49 → 142	Immunoglobulin V-set domain	Domain
PF08205	C2-set_2	148 → 230	CD80-like C2-set immunoglobulin domain	Domain
PF13927	Ig_3	242 → 317		Domain

Sequence

MASVVLPSGSQCAAAAAAAAPPGLRLRLLLLLFSAAALIPTGDGQNLFTKDVTVIEGEVA
TISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEG
RYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWF
KGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQ
YKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFI
NNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPPTTIPPPTTTTTTTTTTTTTILTIITD
SRAGEEGSIRAVDHAVIGGVVAVVVFAMLCLLIILGRYFARHKGTYFTHEAKGADDAADA
DTAIINAEGGQNNSEEKKEYFI

Sequence length

442

Interactions

View interactions

	KEGG		Reactome
	Cell adhesion molecules		Adherens junctions interactions Nectin/Necl trans heterodimerization

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (22)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EATING DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (211)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	21045196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	12432281, 12942568, 16534787, 23032747, 24367507, 26222671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12432281, 12942568, 16108829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	12432281, 12942568, 14559819, 16108829, 31069869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	12432281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	22825485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	20709797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	14688019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	15471956, 16128739, 22289924, 22429880, 28940014, 29600938, 29928911, 30131958, 30837480, 30988755, 31515833, 31642546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	LHGDN	18922876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	39596356	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	40430038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	17300670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	GWASCAT_DG	31308545		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorexia Nervosa	Anorexia nervosa	Pubtator	35470453	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	36851682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	36604807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	31616473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	18957284, 21364653, 22272290, 27594578, 31827744		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	LHGDN	18957284		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	18957284		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	23575222	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30719104, 31515833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	18070176, 30719104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	24833255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	29324443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12112527, 17260099, 21526423, 29228687, 29434950, 30655848, 31579252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	17260099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22106898, 36536459	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	23504322, 24833255	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	16083501, 17009984	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20208141, 23136087, 33663040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	14970278, 15811952, 16128739, 16205641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22528944, 25159494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29734164	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	18498117, 21190187, 25281766, 30172480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	16534787	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	18070176, 30719104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	23136087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12079507, 12799182, 12942568, 14639656, 16205641, 16534787, 21067843, 23503473, 23504322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	27146728, 28637314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	12432281, 18820670	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25031695	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	19047905, 25065733, 27424798	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	28531111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	30998704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	30998704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	14970278, 15589594, 18498117, 20208141, 23456988, 25845528, 26219541, 26552048, 27430395, 30608989, 30945386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	21643982, 23456988, 26219541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	14970278, 15589594, 18498117, 21643982, 23456988, 25845528, 26219541, 26552048, 27430395, 30608989, 30945386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	14688019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31316980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22851235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	22851235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20340131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	19995226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35845138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25031695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	20375924, 23047161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression, Neurotic	Mental Depression	CTD_human_DG	22113448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	CTD_human_DG	22113448		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Syndrome	Mental Depression	CTD_human_DG	22113448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29070574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	23047161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endogenous depression	Mental Depression	CTD_human_DG	22113448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	25281766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	22926846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	23310950, 28510248	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ganglioneuroma	Ganglioneuroma	BEFREE	26463893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	34257559	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23907434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	29921422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23907434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17130425, 25031725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	17130425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25031725	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	31316980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	20824105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome, Familial	Guillain-Barre Syndrome	BEFREE	20824105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	34294150	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	30934002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	20709797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	20709797	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	37291193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	37291193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23301758	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29341891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	15150161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	34257559	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	31275114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	35441431	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	31515833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29070574, 31316980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	23136087	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	23136087, 30267217, 31819525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20215110, 37814227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19835597, 21045196	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	19835597, 21045196, 25491945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	15471956, 16128739, 22429880, 29600938, 30131958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	LHGDN	15471956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21271221, 22237452, 22528944, 25159494, 27298105, 29734164, 31118799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	12799182, 12925956, 18342568, 31069869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	14633730, 16205641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21067843	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	LHGDN	17018592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21436696, 28510248	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23136087, 33663040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	22289924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	28420814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	19115211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	31515833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12112527, 17260099, 21526423, 23504322, 29228687, 29434950, 30655848, 31579252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	17260099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	25281766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	23136087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	22237452, 31118799, 31171015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11536053, 12079507, 12799182, 12925956, 14639656, 16205641, 21067843, 23503473, 23504322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11279526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of penis	Penile cancer	BEFREE	23998425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12079507, 16128739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12716461, 26464628, 31389606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	27055844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	18070176, 30719104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12925956, 14639656, 16532039, 18084322, 20375924, 21329006, 22851235, 23504322, 23907434, 23998425, 26768780, 27430395, 28510248, 30135508, 31402947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	14970278, 15589594, 18498117, 23456988, 25845528, 26219541, 26552048, 27430395, 30608989, 30945386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22851235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	17260099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12112527, 17260099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	17260099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	17260099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	14688019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	CTD_human_DG	22113448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	28843749		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	20375924, 23047161, 27424798, 28843749, 30911007, 31334110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	30911007, 33000202	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	15535129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	17130425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	15150161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	LHGDN	18332875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	18332875	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29523664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	30172480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	19047905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	37019174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	31515833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	21286011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	21286011	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	14639656, 15382043, 16229803, 17018592, 29070520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	16229803, 21535891	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	29070520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11279526, 11536053, 11595164, 12079507, 12112527, 12234973, 12362275, 12432281, 12716461, 12799182, 12925956, 12942568, 12973698, 14559819, 14633730 View all (64 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	18084322, 18559103, 18726896, 20190806, 26463893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	15542977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	29627007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nevi and Melanomas	Congenital melanocytic nevus syndrome	BEFREE	28843749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11279526, 12234973, 12362275, 12716461, 12925956, 12973698, 14559819, 14633730, 15184878, 16128739, 16205641, 21067843, 21526423, 23503473, 24367507, 28765887, 29928911 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	30921768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28628102, 29228687		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	34974810	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30153287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	30153287, 38191892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21436696, 31865146	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33663040, 34395181	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11279526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	12432281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	12432281, 28904340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	28940014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	18957284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12079507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12079507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21062931, 8689504	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Protein C Deficiency	Protein C Deficiency	BEFREE	25306186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	24092566, 29892598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25031695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	22278416	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	27298105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	19158264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	31515833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	31515833	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	23047161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	16205641, 22429880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	14559819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16166431, 18498117, 19147580, 25065733, 26222671, 27035095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	14559819, 23310950, 28510248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23136087	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25065733, 37114505, 38030062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	25065733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	23812766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of vulva	Carcinoma Of Vulva	BEFREE	19047905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26464628, 31389606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12716461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12716461, 31389606	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	19115211		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	LHGDN	19115211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	22207107	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	36523593	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	36523593	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	29341891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	29341891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	23948975, 26908167, 31836816, 36536459	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30655848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	16482617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	CTD_human_DG	22113448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	17009984	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	24508839	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	30135508, 35241698	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17009984, 25845528	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17971771, 20208141, 23176198, 26517242, 26552048, 26768780, 30135508, 31067838, 40534305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	35426938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	29904913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	19643986, 25306186	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CADM1 (cell adhesion molecule 1)