Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23678
Gene name	Serum/glucocorticoid regulated kinase family member 3
Gene symbol	SGK3
Synonyms (NCBI Gene)	CISKSGK2SGKL
Chromosome	8
Chromosome location	8q13.1
Summary	This gene is a member of the Ser/Thr protein kinase family and encodes a phosphoprotein with a PX (phox homology) domain. The protein phosphorylates several target proteins and has a role in neutral amino acid transport and activation of potassium and chl

365

Show/Hide all (365)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023535	hsa-miR-1-3p	Microarray	18668037
MIRT027909	hsa-miR-96-5p	Sequencing	20371350
MIRT002408	hsa-miR-21-5p	Sequencing	20371350
MIRT031504	hsa-miR-16-5p	Sequencing	20371350
MIRT653895	hsa-miR-4781-3p	HITS-CLIP	23824327
MIRT653894	hsa-miR-3155a	HITS-CLIP	23824327
MIRT653893	hsa-miR-3155b	HITS-CLIP	23824327
MIRT653892	hsa-miR-484	HITS-CLIP	23824327
MIRT653891	hsa-miR-4716-5p	HITS-CLIP	23824327
MIRT653890	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT653889	hsa-miR-5695	HITS-CLIP	23824327
MIRT653888	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT653887	hsa-miR-3663-5p	HITS-CLIP	23824327
MIRT653886	hsa-miR-6131	HITS-CLIP	23824327
MIRT653884	hsa-miR-6801-5p	HITS-CLIP	23824327
MIRT653885	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT653883	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT653882	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT653880	hsa-miR-5587-5p	HITS-CLIP	23824327
MIRT653881	hsa-miR-6843-3p	HITS-CLIP	23824327
MIRT653879	hsa-miR-6848-3p	HITS-CLIP	23824327
MIRT106238	hsa-miR-708-3p	HITS-CLIP	23824327
MIRT622302	hsa-miR-5003-3p	HITS-CLIP	23824327
MIRT622301	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT622300	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT622299	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT622298	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT106269	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT106278	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT106268	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT737265	hsa-miR-590-3p	Luciferase reporter assayWestern blottingqRT-PCR	32644852
MIRT653895	hsa-miR-4781-3p	HITS-CLIP	23824327
MIRT653894	hsa-miR-3155a	HITS-CLIP	23824327
MIRT653893	hsa-miR-3155b	HITS-CLIP	23824327
MIRT653892	hsa-miR-484	HITS-CLIP	23824327
MIRT653891	hsa-miR-4716-5p	HITS-CLIP	23824327
MIRT653890	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT653889	hsa-miR-5695	HITS-CLIP	23824327
MIRT653888	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT653887	hsa-miR-3663-5p	HITS-CLIP	23824327
MIRT653886	hsa-miR-6131	HITS-CLIP	23824327
MIRT653884	hsa-miR-6801-5p	HITS-CLIP	23824327
MIRT653885	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT653883	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT653882	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT653880	hsa-miR-5587-5p	HITS-CLIP	23824327
MIRT653881	hsa-miR-6843-3p	HITS-CLIP	23824327
MIRT653879	hsa-miR-6848-3p	HITS-CLIP	23824327
MIRT106238	hsa-miR-708-3p	HITS-CLIP	23824327
MIRT622302	hsa-miR-5003-3p	HITS-CLIP	23824327
MIRT622301	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT622300	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT622299	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT622298	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT1343219	hsa-miR-106a	CLIP-seq
MIRT1343220	hsa-miR-106b	CLIP-seq
MIRT1343221	hsa-miR-1178	CLIP-seq
MIRT1343222	hsa-miR-1287	CLIP-seq
MIRT1343223	hsa-miR-17	CLIP-seq
MIRT1343224	hsa-miR-1910	CLIP-seq
MIRT1343225	hsa-miR-20a	CLIP-seq
MIRT1343226	hsa-miR-20b	CLIP-seq
MIRT1343227	hsa-miR-21	CLIP-seq
MIRT1343228	hsa-miR-302a	CLIP-seq
MIRT1343229	hsa-miR-302b	CLIP-seq
MIRT1343230	hsa-miR-302c	CLIP-seq
MIRT1343231	hsa-miR-302d	CLIP-seq
MIRT1343232	hsa-miR-302e	CLIP-seq
MIRT1343233	hsa-miR-3135b	CLIP-seq
MIRT1343234	hsa-miR-372	CLIP-seq
MIRT1343235	hsa-miR-373	CLIP-seq
MIRT1343236	hsa-miR-4477a	CLIP-seq
MIRT1343237	hsa-miR-455-3p	CLIP-seq
MIRT1343238	hsa-miR-512-3p	CLIP-seq
MIRT1343239	hsa-miR-513a-3p	CLIP-seq
MIRT1343240	hsa-miR-519d	CLIP-seq
MIRT1343241	hsa-miR-520a-3p	CLIP-seq
MIRT1343242	hsa-miR-520b	CLIP-seq
MIRT1343243	hsa-miR-520c-3p	CLIP-seq
MIRT1343244	hsa-miR-520d-3p	CLIP-seq
MIRT1343245	hsa-miR-520e	CLIP-seq
MIRT1343246	hsa-miR-520g	CLIP-seq
MIRT1343247	hsa-miR-520h	CLIP-seq
MIRT1343248	hsa-miR-590-5p	CLIP-seq
MIRT1343249	hsa-miR-93	CLIP-seq
MIRT1343219	hsa-miR-106a	CLIP-seq
MIRT1343220	hsa-miR-106b	CLIP-seq
MIRT1343250	hsa-miR-1234	CLIP-seq
MIRT1343251	hsa-miR-1281	CLIP-seq
MIRT1343252	hsa-miR-1305	CLIP-seq
MIRT1343253	hsa-miR-1307	CLIP-seq
MIRT1343254	hsa-miR-1323	CLIP-seq
MIRT1343255	hsa-miR-150	CLIP-seq
MIRT1343256	hsa-miR-15a	CLIP-seq
MIRT1343257	hsa-miR-15b	CLIP-seq
MIRT1343258	hsa-miR-16	CLIP-seq
MIRT1343223	hsa-miR-17	CLIP-seq
MIRT1343259	hsa-miR-195	CLIP-seq
MIRT1343260	hsa-miR-1976	CLIP-seq
MIRT1343261	hsa-miR-203	CLIP-seq
MIRT1343262	hsa-miR-2053	CLIP-seq
MIRT1343225	hsa-miR-20a	CLIP-seq
MIRT1343226	hsa-miR-20b	CLIP-seq
MIRT1343263	hsa-miR-2116	CLIP-seq
MIRT1343264	hsa-miR-25	CLIP-seq
MIRT1343265	hsa-miR-300	CLIP-seq
MIRT1343228	hsa-miR-302a	CLIP-seq
MIRT1343229	hsa-miR-302b	CLIP-seq
MIRT1343230	hsa-miR-302c	CLIP-seq
MIRT1343231	hsa-miR-302d	CLIP-seq
MIRT1343232	hsa-miR-302e	CLIP-seq
MIRT1343266	hsa-miR-3152-3p	CLIP-seq
MIRT1343267	hsa-miR-3157-3p	CLIP-seq
MIRT1343268	hsa-miR-32	CLIP-seq
MIRT1343269	hsa-miR-338-5p	CLIP-seq
MIRT1343270	hsa-miR-3545-3p	CLIP-seq
MIRT1343271	hsa-miR-363	CLIP-seq
MIRT1343272	hsa-miR-365	CLIP-seq
MIRT1343273	hsa-miR-367	CLIP-seq
MIRT1343274	hsa-miR-3682-5p	CLIP-seq
MIRT1343234	hsa-miR-372	CLIP-seq
MIRT1343235	hsa-miR-373	CLIP-seq
MIRT1343275	hsa-miR-375	CLIP-seq
MIRT1343276	hsa-miR-376c	CLIP-seq
MIRT1343277	hsa-miR-381	CLIP-seq
MIRT1343278	hsa-miR-3929	CLIP-seq
MIRT1343279	hsa-miR-424	CLIP-seq
MIRT1343280	hsa-miR-4273	CLIP-seq
MIRT1343281	hsa-miR-4279	CLIP-seq
MIRT1343282	hsa-miR-4284	CLIP-seq
MIRT1343283	hsa-miR-4325	CLIP-seq
MIRT1343284	hsa-miR-4419b	CLIP-seq
MIRT1343285	hsa-miR-4438	CLIP-seq
MIRT1343286	hsa-miR-4478	CLIP-seq
MIRT1343287	hsa-miR-4524	CLIP-seq
MIRT1343288	hsa-miR-4532	CLIP-seq
MIRT1343289	hsa-miR-4635	CLIP-seq
MIRT1343290	hsa-miR-4638-5p	CLIP-seq
MIRT1343291	hsa-miR-4666-3p	CLIP-seq
MIRT1343292	hsa-miR-4677-5p	CLIP-seq
MIRT1343293	hsa-miR-4680-5p	CLIP-seq
MIRT1343294	hsa-miR-4699-3p	CLIP-seq
MIRT1343295	hsa-miR-4722-3p	CLIP-seq
MIRT1343296	hsa-miR-4731-5p	CLIP-seq
MIRT1343297	hsa-miR-4772-3p	CLIP-seq
MIRT1343298	hsa-miR-4775	CLIP-seq
MIRT1343299	hsa-miR-497	CLIP-seq
MIRT1343300	hsa-miR-498	CLIP-seq
MIRT1343301	hsa-miR-503	CLIP-seq
MIRT1343302	hsa-miR-5095	CLIP-seq
MIRT1343238	hsa-miR-512-3p	CLIP-seq
MIRT1343239	hsa-miR-513a-3p	CLIP-seq
MIRT1343240	hsa-miR-519d	CLIP-seq
MIRT1343241	hsa-miR-520a-3p	CLIP-seq
MIRT1343242	hsa-miR-520b	CLIP-seq
MIRT1343243	hsa-miR-520c-3p	CLIP-seq
MIRT1343244	hsa-miR-520d-3p	CLIP-seq
MIRT1343245	hsa-miR-520e	CLIP-seq
MIRT1343246	hsa-miR-520g	CLIP-seq
MIRT1343247	hsa-miR-520h	CLIP-seq
MIRT1343303	hsa-miR-548c-3p	CLIP-seq
MIRT1343304	hsa-miR-548o	CLIP-seq
MIRT1343305	hsa-miR-578	CLIP-seq
MIRT1343306	hsa-miR-646	CLIP-seq
MIRT1343307	hsa-miR-92a	CLIP-seq
MIRT1343308	hsa-miR-92b	CLIP-seq
MIRT1343249	hsa-miR-93	CLIP-seq
MIRT1343219	hsa-miR-106a	CLIP-seq
MIRT1343220	hsa-miR-106b	CLIP-seq
MIRT2101416	hsa-miR-1254	CLIP-seq
MIRT1343251	hsa-miR-1281	CLIP-seq
MIRT1343255	hsa-miR-150	CLIP-seq
MIRT1343223	hsa-miR-17	CLIP-seq
MIRT2101417	hsa-miR-1913	CLIP-seq
MIRT1343260	hsa-miR-1976	CLIP-seq
MIRT1343225	hsa-miR-20a	CLIP-seq
MIRT1343226	hsa-miR-20b	CLIP-seq
MIRT1343228	hsa-miR-302a	CLIP-seq
MIRT1343229	hsa-miR-302b	CLIP-seq
MIRT1343230	hsa-miR-302c	CLIP-seq
MIRT1343231	hsa-miR-302d	CLIP-seq
MIRT1343232	hsa-miR-302e	CLIP-seq
MIRT2101418	hsa-miR-3116	CLIP-seq
MIRT2101419	hsa-miR-3176	CLIP-seq
MIRT2101420	hsa-miR-324-3p	CLIP-seq
MIRT1343234	hsa-miR-372	CLIP-seq
MIRT1343235	hsa-miR-373	CLIP-seq
MIRT2101421	hsa-miR-3922-3p	CLIP-seq
MIRT2101422	hsa-miR-4277	CLIP-seq
MIRT1343281	hsa-miR-4279	CLIP-seq
MIRT1343285	hsa-miR-4438	CLIP-seq
MIRT1343288	hsa-miR-4532	CLIP-seq
MIRT2101423	hsa-miR-4707-3p	CLIP-seq
MIRT1343295	hsa-miR-4722-3p	CLIP-seq
MIRT1343296	hsa-miR-4731-5p	CLIP-seq
MIRT1343297	hsa-miR-4772-3p	CLIP-seq
MIRT1343300	hsa-miR-498	CLIP-seq
MIRT1343302	hsa-miR-5095	CLIP-seq
MIRT1343238	hsa-miR-512-3p	CLIP-seq
MIRT1343240	hsa-miR-519d	CLIP-seq
MIRT1343241	hsa-miR-520a-3p	CLIP-seq
MIRT1343242	hsa-miR-520b	CLIP-seq
MIRT1343243	hsa-miR-520c-3p	CLIP-seq
MIRT1343244	hsa-miR-520d-3p	CLIP-seq
MIRT1343245	hsa-miR-520e	CLIP-seq
MIRT1343246	hsa-miR-520g	CLIP-seq
MIRT1343247	hsa-miR-520h	CLIP-seq
MIRT1343303	hsa-miR-548c-3p	CLIP-seq
MIRT2101424	hsa-miR-562	CLIP-seq
MIRT2101425	hsa-miR-661	CLIP-seq
MIRT1343249	hsa-miR-93	CLIP-seq
MIRT1343219	hsa-miR-106a	CLIP-seq
MIRT1343220	hsa-miR-106b	CLIP-seq
MIRT1343221	hsa-miR-1178	CLIP-seq
MIRT2325793	hsa-miR-1227	CLIP-seq
MIRT1343250	hsa-miR-1234	CLIP-seq
MIRT2325794	hsa-miR-1245	CLIP-seq
MIRT1343251	hsa-miR-1281	CLIP-seq
MIRT1343222	hsa-miR-1287	CLIP-seq
MIRT1343254	hsa-miR-1323	CLIP-seq
MIRT2325795	hsa-miR-142-5p	CLIP-seq
MIRT1343255	hsa-miR-150	CLIP-seq
MIRT1343256	hsa-miR-15a	CLIP-seq
MIRT1343257	hsa-miR-15b	CLIP-seq
MIRT1343258	hsa-miR-16	CLIP-seq
MIRT1343223	hsa-miR-17	CLIP-seq
MIRT1343224	hsa-miR-1910	CLIP-seq
MIRT1343259	hsa-miR-195	CLIP-seq
MIRT1343260	hsa-miR-1976	CLIP-seq
MIRT1343261	hsa-miR-203	CLIP-seq
MIRT1343262	hsa-miR-2053	CLIP-seq
MIRT1343225	hsa-miR-20a	CLIP-seq
MIRT1343226	hsa-miR-20b	CLIP-seq
MIRT1343228	hsa-miR-302a	CLIP-seq
MIRT1343229	hsa-miR-302b	CLIP-seq
MIRT1343230	hsa-miR-302c	CLIP-seq
MIRT1343231	hsa-miR-302d	CLIP-seq
MIRT1343232	hsa-miR-302e	CLIP-seq
MIRT1343233	hsa-miR-3135b	CLIP-seq
MIRT1343266	hsa-miR-3152-3p	CLIP-seq
MIRT1343267	hsa-miR-3157-3p	CLIP-seq
MIRT2325796	hsa-miR-3199	CLIP-seq
MIRT1343270	hsa-miR-3545-3p	CLIP-seq
MIRT1343272	hsa-miR-365	CLIP-seq
MIRT1343234	hsa-miR-372	CLIP-seq
MIRT1343235	hsa-miR-373	CLIP-seq
MIRT1343276	hsa-miR-376c	CLIP-seq
MIRT2325797	hsa-miR-3910	CLIP-seq
MIRT1343278	hsa-miR-3929	CLIP-seq
MIRT1343279	hsa-miR-424	CLIP-seq
MIRT2101422	hsa-miR-4277	CLIP-seq
MIRT1343281	hsa-miR-4279	CLIP-seq
MIRT2325798	hsa-miR-4312	CLIP-seq
MIRT1343284	hsa-miR-4419b	CLIP-seq
MIRT2325799	hsa-miR-4420	CLIP-seq
MIRT1343285	hsa-miR-4438	CLIP-seq
MIRT1343286	hsa-miR-4478	CLIP-seq
MIRT2325800	hsa-miR-4484	CLIP-seq
MIRT2325801	hsa-miR-4509	CLIP-seq
MIRT1343287	hsa-miR-4524	CLIP-seq
MIRT1343288	hsa-miR-4532	CLIP-seq
MIRT1343237	hsa-miR-455-3p	CLIP-seq
MIRT2325802	hsa-miR-455-5p	CLIP-seq
MIRT1343293	hsa-miR-4680-5p	CLIP-seq
MIRT2325803	hsa-miR-4715-3p	CLIP-seq
MIRT1343295	hsa-miR-4722-3p	CLIP-seq
MIRT1343296	hsa-miR-4731-5p	CLIP-seq
MIRT2325804	hsa-miR-4757-5p	CLIP-seq
MIRT1343297	hsa-miR-4772-3p	CLIP-seq
MIRT1343298	hsa-miR-4775	CLIP-seq
MIRT1343299	hsa-miR-497	CLIP-seq
MIRT1343300	hsa-miR-498	CLIP-seq
MIRT1343301	hsa-miR-503	CLIP-seq
MIRT1343302	hsa-miR-5095	CLIP-seq
MIRT1343238	hsa-miR-512-3p	CLIP-seq
MIRT1343240	hsa-miR-519d	CLIP-seq
MIRT1343241	hsa-miR-520a-3p	CLIP-seq
MIRT1343242	hsa-miR-520b	CLIP-seq
MIRT1343243	hsa-miR-520c-3p	CLIP-seq
MIRT1343244	hsa-miR-520d-3p	CLIP-seq
MIRT1343245	hsa-miR-520e	CLIP-seq
MIRT1343246	hsa-miR-520g	CLIP-seq
MIRT1343247	hsa-miR-520h	CLIP-seq
MIRT2325805	hsa-miR-548an	CLIP-seq
MIRT1343303	hsa-miR-548c-3p	CLIP-seq
MIRT1343304	hsa-miR-548o	CLIP-seq
MIRT2325806	hsa-miR-548p	CLIP-seq
MIRT2325807	hsa-miR-561	CLIP-seq
MIRT2101424	hsa-miR-562	CLIP-seq
MIRT2325808	hsa-miR-569	CLIP-seq
MIRT1343305	hsa-miR-578	CLIP-seq
MIRT1343306	hsa-miR-646	CLIP-seq
MIRT2325809	hsa-miR-891b	CLIP-seq
MIRT1343249	hsa-miR-93	CLIP-seq
MIRT2325810	hsa-miR-944	CLIP-seq
MIRT1343219	hsa-miR-106a	CLIP-seq
MIRT1343220	hsa-miR-106b	CLIP-seq
MIRT2325793	hsa-miR-1227	CLIP-seq
MIRT2621589	hsa-miR-1231	CLIP-seq
MIRT2621590	hsa-miR-125a-3p	CLIP-seq
MIRT1343251	hsa-miR-1281	CLIP-seq
MIRT2621591	hsa-miR-129-5p	CLIP-seq
MIRT2621592	hsa-miR-149	CLIP-seq
MIRT1343255	hsa-miR-150	CLIP-seq
MIRT1343223	hsa-miR-17	CLIP-seq
MIRT2101417	hsa-miR-1913	CLIP-seq
MIRT1343260	hsa-miR-1976	CLIP-seq
MIRT1343225	hsa-miR-20a	CLIP-seq
MIRT1343226	hsa-miR-20b	CLIP-seq
MIRT1343228	hsa-miR-302a	CLIP-seq
MIRT1343229	hsa-miR-302b	CLIP-seq
MIRT1343230	hsa-miR-302c	CLIP-seq
MIRT1343231	hsa-miR-302d	CLIP-seq
MIRT1343232	hsa-miR-302e	CLIP-seq
MIRT2621593	hsa-miR-3064-5p	CLIP-seq
MIRT2621594	hsa-miR-3149	CLIP-seq
MIRT2101420	hsa-miR-324-3p	CLIP-seq
MIRT2621595	hsa-miR-3674	CLIP-seq
MIRT1343234	hsa-miR-372	CLIP-seq
MIRT1343235	hsa-miR-373	CLIP-seq
MIRT2621596	hsa-miR-3934	CLIP-seq
MIRT1343281	hsa-miR-4279	CLIP-seq
MIRT1343285	hsa-miR-4438	CLIP-seq
MIRT1343288	hsa-miR-4532	CLIP-seq
MIRT2325802	hsa-miR-455-5p	CLIP-seq
MIRT2101423	hsa-miR-4707-3p	CLIP-seq
MIRT2325803	hsa-miR-4715-3p	CLIP-seq
MIRT1343295	hsa-miR-4722-3p	CLIP-seq
MIRT1343296	hsa-miR-4731-5p	CLIP-seq
MIRT2621597	hsa-miR-4735-5p	CLIP-seq
MIRT1343298	hsa-miR-4775	CLIP-seq
MIRT2621598	hsa-miR-4794	CLIP-seq
MIRT1343300	hsa-miR-498	CLIP-seq
MIRT1343302	hsa-miR-5095	CLIP-seq
MIRT1343238	hsa-miR-512-3p	CLIP-seq
MIRT1343240	hsa-miR-519d	CLIP-seq
MIRT1343241	hsa-miR-520a-3p	CLIP-seq
MIRT1343242	hsa-miR-520b	CLIP-seq
MIRT1343243	hsa-miR-520c-3p	CLIP-seq
MIRT1343244	hsa-miR-520d-3p	CLIP-seq
MIRT1343245	hsa-miR-520e	CLIP-seq
MIRT1343246	hsa-miR-520g	CLIP-seq
MIRT1343247	hsa-miR-520h	CLIP-seq
MIRT2621599	hsa-miR-654-3p	CLIP-seq
MIRT2621600	hsa-miR-764	CLIP-seq
MIRT1343249	hsa-miR-93	CLIP-seq
MIRT2325793	hsa-miR-1227	CLIP-seq
MIRT2621589	hsa-miR-1231	CLIP-seq
MIRT1343251	hsa-miR-1281	CLIP-seq
MIRT2621591	hsa-miR-129-5p	CLIP-seq
MIRT2621592	hsa-miR-149	CLIP-seq
MIRT1343260	hsa-miR-1976	CLIP-seq
MIRT2621593	hsa-miR-3064-5p	CLIP-seq
MIRT2621594	hsa-miR-3149	CLIP-seq
MIRT1343281	hsa-miR-4279	CLIP-seq
MIRT1343288	hsa-miR-4532	CLIP-seq
MIRT2325802	hsa-miR-455-5p	CLIP-seq
MIRT2325803	hsa-miR-4715-3p	CLIP-seq
MIRT1343295	hsa-miR-4722-3p	CLIP-seq
MIRT2621597	hsa-miR-4735-5p	CLIP-seq
MIRT1343298	hsa-miR-4775	CLIP-seq
MIRT2621598	hsa-miR-4794	CLIP-seq
MIRT1343300	hsa-miR-498	CLIP-seq
MIRT2690585	hsa-miR-628-5p	CLIP-seq
MIRT2621599	hsa-miR-654-3p	CLIP-seq

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001558	Process	Regulation of cell growth	IEA
GO:0001558	Process	Regulation of cell growth	TAS	20919962
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	10548550, 10585774
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	10548550
GO:0005246	Function	Calcium channel regulator activity	TAS	16460280
GO:0005515	Function	Protein binding	IPI	16888620
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	TAS	10548550
GO:0015459	Function	Potassium channel regulator activity	IBA
GO:0015459	Function	Potassium channel regulator activity	TAS	16460280
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0017080	Function	Sodium channel regulator activity	IEA
GO:0017080	Function	Sodium channel regulator activity	TAS	16460280
GO:0017081	Function	Chloride channel regulator activity	TAS	16460280
GO:0030334	Process	Regulation of cell migration	TAS	20919962
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0035091	Function	Phosphatidylinositol binding	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042127	Process	Regulation of cell population proliferation	TAS	20919962
GO:0051090	Process	Regulation of DNA-binding transcription factor activity	TAS	20919962
GO:0055037	Component	Recycling endosome	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA

MIM	HGNC	e!Ensembl
607591	10812	ENSG00000104205

Q96BR1

Protein name

Serine/threonine-protein kinase Sgk3 (EC 2.7.11.1) (Cytokine-independent survival kinase) (Serum/glucocorticoid-regulated kinase 3) (Serum/glucocorticoid-regulated kinase-like)

Protein function

Serine/threonine-protein kinase which is involved in the regulation of a wide variety of ion channels, membrane transporters, cell growth, proliferation, survival and migration. Up-regulates Na(+) channels: SCNN1A/ENAC and SCN5A, K(+) channels:

PDB

6EDX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00787	PX	38 → 120	PX domain	Domain
PF00069	Pkinase	162 → 419	Protein kinase domain	Domain
PF00433	Pkinase_C	440 → 487	Protein kinase C terminal domain	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in most tissues with highest levels in pancreas, kidney liver, heart and brain and lower levels in lung, placenta and skeletal muscle. Expression is higher in ER-positive breast tumors than ER-negative breast tumors. {ECO:000

Sequence

MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNT
LKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMD
SPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAK
RKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVL
DFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHV
VLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPP
FYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFE
SLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADD
AFVGFSYAPPSEDLFL

Sequence length

496

Interactions

View interactions

	KEGG		Reactome
	FoxO signaling pathway PI3K-Akt signaling pathway		Stimuli-sensing channels

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOPHOSPHATEMIC RICKETS	—	Disgenet, GenCC Disgenet, GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (50)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	30927068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	26830138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal dominant hypophosphatemic rickets	Hypophosphatemic Rickets	BEFREE	31821448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30588263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21084382, 22576469, 25458846, 28174265, 31182914, 31461270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21084382, 22576469, 31665227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33783250	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27602769, 28639896, 35655171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30588263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31002126, 31114998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26411369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33783250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31114998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	37398883	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Hypophosphatemic Rickets	Hypophosphatemic Rickets	BEFREE	31821448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33783250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25720694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27560795, 31734653	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypophosphatemic Rickets	Hypophosphatemic Rickets	BEFREE	31821448		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	27560795	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	31002126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	29343273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	29343273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29343273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22262416, 28639896, 28849156, 29940988, 30975125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	28639896, 30975125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21084382, 22576469, 25458846, 28174265, 31182914, 31461270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31002126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24739041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30588263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29150437, 29940988, 30245963, 31461270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26411369		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25712345, 26573229, 28656250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microvillus inclusion disease	Microvillus inclusion disease	Pubtator	37643022	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	25837824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21084382, 22576469, 25458846, 30975125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	21084382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30250399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33613114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30328340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	34740363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24739041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24739041	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33783250, 36720852	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31002126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31002126, 31114998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	39272022	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25615606, 29516642, 32432732	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SGK3 (serum/glucocorticoid regulated kinase family member 3)