Gene Gene information from NCBI Gene database.
Entrez ID 23659
Gene name Phospholipase A2 group XV
Gene symbol PLA2G15
Synonyms (NCBI Gene)
ACSGXVPLA2LLPLLPLA2LYPLA3
Chromosome 16
Chromosome location 16q22.1
Summary Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine to glycerophosphorylcholine and a free fatty acid. This enzyme is presen
miRNA miRNA information provided by mirtarbase database.
437
miRTarBase ID miRNA Experiments Reference
MIRT1238535 hsa-let-7a CLIP-seq
MIRT1238536 hsa-let-7b CLIP-seq
MIRT1238537 hsa-let-7c CLIP-seq
MIRT1238538 hsa-let-7d CLIP-seq
MIRT1238539 hsa-let-7e CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
59
GO ID Ontology Definition Evidence Reference
GO:0004622 Function Phosphatidylcholine lysophospholipase activity IEA
GO:0004622 Function Phosphatidylcholine lysophospholipase activity TAS 10092508
GO:0004623 Function Phospholipase A2 activity IEA
GO:0005515 Function Protein binding IPI 33961781
GO:0005543 Function Phospholipid binding TAS 10092508
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609362 17163 ENSG00000103066
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NCC3
Protein name Lysosomal phospholipase A and acyltransferase (EC 2.3.1.-) (EC 3.1.1.32) (EC 3.1.1.4) (1-O-acylceramide synthase) (ACS) (LCAT-like lysophospholipase) (LLPL) (EC 3.1.1.5) (Lysophospholipase 3) (Lysosomal phospholipase A2) (LPLA2) (Phospholipase A2 group XV
Protein function Has dual calcium-independent phospholipase and O-acyltransferase activities with a potential role in glycerophospholipid homeostasis and remodeling of acyl groups of lipophilic alcohols present in acidic cellular compartments (PubMed:10092508, P
PDB 4X90 , 4X91 , 4X92 , 4X93 , 4X94 , 4X95 , 4X97 , 6MTW
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02450 LCAT 72 318 Lecithin:cholesterol acyltransferase Family
PF02450 LCAT 309 399 Lecithin:cholesterol acyltransferase Family
Tissue specificity TISSUE SPECIFICITY: Detected in blood plasma (at protein level) (PubMed:10092508, PubMed:20410020). Ubiquitous. Highly expressed in heart, placenta, skeletal muscle, kidney and pancreas. Detected at lower levels in spleen, thymus, prostate, testis, ovary,
Sequence
MGLHLRPYRVGLLPDGLLFLLLLLMLLADPALPAGRHPPVVLVPGDLGNQLEAKLDKPTV
VHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGK
TFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREM
IEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVL
ASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQ
DIGFEDGW
LMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGD
GTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANA
TTLAYLKRVLLGP
Sequence length 412
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Glycerophospholipid metabolism
Lysosome
Efferocytosis
  Hydrolysis of LPC
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ATOPIC ASTHMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute Coronary Syndrome Coronary Syndrome BEFREE 17706812, 22575314, 23136988, 28089149, 28233628, 28267469, 28511772, 28545849, 28838475, 28855078, 28947562, 28982673, 29437596, 29499359, 29601956
View all (24 more)
★☆☆☆☆
Found in Text Mining only
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 30023654
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of pancreas Pancreatic adenocarcinoma BEFREE 28747265
★☆☆☆☆
Found in Text Mining only
Adult Acute Lymphocytic Leukemia Lymphocytic Leukemia BEFREE 30023654
★☆☆☆☆
Found in Text Mining only
alpha Thalassemia Alpha thalassemia Pubtator 6725554 Associate
★☆☆☆☆
Found in Text Mining only
Aortic Aneurysm, Abdominal Aortic Aneurysm BEFREE 28483623, 31226476
★☆☆☆☆
Found in Text Mining only
Aortic Valve Insufficiency Aortic Valve Insufficiency BEFREE 29288564
★☆☆☆☆
Found in Text Mining only
Appendicitis Appendicitis BEFREE 28654543, 28693849, 30635205, 31388806
★☆☆☆☆
Found in Text Mining only
Arteriosclerosis Arteriosclerosis BEFREE 27796172, 31504738
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Atherosclerosis BEFREE 27796172, 31504738
★☆☆☆☆
Found in Text Mining only