Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23650
Gene name	Tripartite motif containing 29
Gene symbol	TRIM29
Synonyms (NCBI Gene)	ATDC
Chromosome	11
Chromosome location	11q23.3
Summary	The protein encoded by this gene belongs to the TRIM protein family. It has multiple zinc finger motifs and a leucine zipper motif. It has been proposed to form homo- or heterodimers which are involved in nucleic acid binding. Thus, it may act as a transc

133

Show/Hide all (133)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002561	hsa-miR-124-3p	Microarray	15685193
MIRT018621	hsa-miR-335-5p	Microarray	18185580
MIRT002561	hsa-miR-124-3p	Microarray;Other	15685193
MIRT023394	hsa-miR-122-5p	Microarray	17612493
MIRT569614	hsa-miR-6510-5p	PAR-CLIP	20371350
MIRT569613	hsa-miR-214-3p	PAR-CLIP	20371350
MIRT569612	hsa-miR-3619-5p	PAR-CLIP	20371350
MIRT569611	hsa-miR-761	PAR-CLIP	20371350
MIRT569610	hsa-miR-6746-5p	PAR-CLIP	20371350
MIRT569609	hsa-miR-4524a-3p	PAR-CLIP	20371350
MIRT569608	hsa-miR-6132	PAR-CLIP	20371350
MIRT569607	hsa-miR-6836-5p	PAR-CLIP	20371350
MIRT569605	hsa-miR-6853-5p	PAR-CLIP	20371350
MIRT569606	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT569604	hsa-miR-8085	PAR-CLIP	20371350
MIRT569603	hsa-miR-1268a	PAR-CLIP	20371350
MIRT569602	hsa-miR-1268b	PAR-CLIP	20371350
MIRT569601	hsa-miR-1228-5p	PAR-CLIP	20371350
MIRT569600	hsa-miR-4526	PAR-CLIP	20371350
MIRT018621	hsa-miR-335-5p	Luciferase reporter assay	26872369
MIRT018621	hsa-miR-335-5p	Luciferase reporter assay	26872369
MIRT731380	hsa-miR-15b-5p	Luciferase reporter assay	26872369
MIRT731380	hsa-miR-15b-5p	Luciferase reporter assay	26872369
MIRT018621	hsa-miR-335-5p	Luciferase reporter assay	26872369
MIRT018621	hsa-miR-335-5p	Luciferase reporter assay	26872369
MIRT731749	hsa-miR-185-5p	Luciferase reporter assayqRT-PCRWestern blot	26191199
MIRT731749	hsa-miR-185-5p	Luciferase reporter assayqRT-PCRWestern blot	26191199
MIRT569614	hsa-miR-6510-5p	PAR-CLIP	20371350
MIRT569613	hsa-miR-214-3p	PAR-CLIP	20371350
MIRT569612	hsa-miR-3619-5p	PAR-CLIP	20371350
MIRT569611	hsa-miR-761	PAR-CLIP	20371350
MIRT569610	hsa-miR-6746-5p	PAR-CLIP	20371350
MIRT569609	hsa-miR-4524a-3p	PAR-CLIP	20371350
MIRT569608	hsa-miR-6132	PAR-CLIP	20371350
MIRT569607	hsa-miR-6836-5p	PAR-CLIP	20371350
MIRT569605	hsa-miR-6853-5p	PAR-CLIP	20371350
MIRT569606	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT569604	hsa-miR-8085	PAR-CLIP	20371350
MIRT569603	hsa-miR-1268a	PAR-CLIP	20371350
MIRT569602	hsa-miR-1268b	PAR-CLIP	20371350
MIRT569601	hsa-miR-1228-5p	PAR-CLIP	20371350
MIRT569600	hsa-miR-4526	PAR-CLIP	20371350
MIRT1453756	hsa-miR-1257	CLIP-seq
MIRT1453757	hsa-miR-1280	CLIP-seq
MIRT1453758	hsa-miR-1293	CLIP-seq
MIRT1453759	hsa-miR-151-3p	CLIP-seq
MIRT1453760	hsa-miR-214	CLIP-seq
MIRT1453761	hsa-miR-2467-3p	CLIP-seq
MIRT1453762	hsa-miR-2681	CLIP-seq
MIRT1453763	hsa-miR-2964a-5p	CLIP-seq
MIRT1453764	hsa-miR-3074-3p	CLIP-seq
MIRT1453765	hsa-miR-3132	CLIP-seq
MIRT1453766	hsa-miR-3137	CLIP-seq
MIRT1453767	hsa-miR-3153	CLIP-seq
MIRT1453768	hsa-miR-3165	CLIP-seq
MIRT1453769	hsa-miR-320e	CLIP-seq
MIRT1453770	hsa-miR-3607-5p	CLIP-seq
MIRT1453771	hsa-miR-3686	CLIP-seq
MIRT1453772	hsa-miR-3689d	CLIP-seq
MIRT1453773	hsa-miR-3973	CLIP-seq
MIRT1453774	hsa-miR-4280	CLIP-seq
MIRT1453775	hsa-miR-4291	CLIP-seq
MIRT1453776	hsa-miR-4433	CLIP-seq
MIRT1453777	hsa-miR-4434	CLIP-seq
MIRT1453778	hsa-miR-4459	CLIP-seq
MIRT1453779	hsa-miR-4463	CLIP-seq
MIRT1453780	hsa-miR-4475	CLIP-seq
MIRT1453781	hsa-miR-4483	CLIP-seq
MIRT1453782	hsa-miR-4499	CLIP-seq
MIRT1453783	hsa-miR-4516	CLIP-seq
MIRT1453784	hsa-miR-4640-5p	CLIP-seq
MIRT1453785	hsa-miR-4646-5p	CLIP-seq
MIRT1453786	hsa-miR-4687-3p	CLIP-seq
MIRT1453787	hsa-miR-4694-3p	CLIP-seq
MIRT1453788	hsa-miR-4722-3p	CLIP-seq
MIRT1453789	hsa-miR-4722-5p	CLIP-seq
MIRT1453790	hsa-miR-4726-5p	CLIP-seq
MIRT1453791	hsa-miR-4747-5p	CLIP-seq
MIRT1453792	hsa-miR-4768-3p	CLIP-seq
MIRT1453793	hsa-miR-4778-5p	CLIP-seq
MIRT1453794	hsa-miR-4786-3p	CLIP-seq
MIRT1453795	hsa-miR-4793-5p	CLIP-seq
MIRT1453796	hsa-miR-4796-3p	CLIP-seq
MIRT1453797	hsa-miR-520g	CLIP-seq
MIRT1453798	hsa-miR-520h	CLIP-seq
MIRT1453799	hsa-miR-522	CLIP-seq
MIRT1453800	hsa-miR-541	CLIP-seq
MIRT1453801	hsa-miR-654-5p	CLIP-seq
MIRT1453802	hsa-miR-661	CLIP-seq
MIRT1453803	hsa-miR-888	CLIP-seq
MIRT1453804	hsa-miR-922	CLIP-seq
MIRT1453756	hsa-miR-1257	CLIP-seq
MIRT2136079	hsa-miR-1287	CLIP-seq
MIRT2136080	hsa-miR-1470	CLIP-seq
MIRT1453760	hsa-miR-214	CLIP-seq
MIRT2136081	hsa-miR-2276	CLIP-seq
MIRT1453767	hsa-miR-3153	CLIP-seq
MIRT1453769	hsa-miR-320e	CLIP-seq
MIRT2136082	hsa-miR-34a	CLIP-seq
MIRT2136083	hsa-miR-34c-5p	CLIP-seq
MIRT1453770	hsa-miR-3607-5p	CLIP-seq
MIRT1453772	hsa-miR-3689d	CLIP-seq
MIRT2136084	hsa-miR-4287	CLIP-seq
MIRT2136085	hsa-miR-4302	CLIP-seq
MIRT2136086	hsa-miR-4447	CLIP-seq
MIRT1453778	hsa-miR-4459	CLIP-seq
MIRT2136087	hsa-miR-4469	CLIP-seq
MIRT2136088	hsa-miR-4472	CLIP-seq
MIRT2136089	hsa-miR-4488	CLIP-seq
MIRT2136090	hsa-miR-449a	CLIP-seq
MIRT2136091	hsa-miR-449b	CLIP-seq
MIRT1453784	hsa-miR-4640-5p	CLIP-seq
MIRT2136092	hsa-miR-4667-3p	CLIP-seq
MIRT2136093	hsa-miR-4685-3p	CLIP-seq
MIRT2136094	hsa-miR-4697-5p	CLIP-seq
MIRT1453789	hsa-miR-4722-5p	CLIP-seq
MIRT1453790	hsa-miR-4726-5p	CLIP-seq
MIRT2136095	hsa-miR-4764-5p	CLIP-seq
MIRT2136096	hsa-miR-486-3p	CLIP-seq
MIRT1453800	hsa-miR-541	CLIP-seq
MIRT1453801	hsa-miR-654-5p	CLIP-seq
MIRT1453760	hsa-miR-214	CLIP-seq
MIRT1453778	hsa-miR-4459	CLIP-seq
MIRT2396346	hsa-miR-15a	CLIP-seq
MIRT2396347	hsa-miR-15b	CLIP-seq
MIRT2396348	hsa-miR-16	CLIP-seq
MIRT2396349	hsa-miR-195	CLIP-seq
MIRT1453760	hsa-miR-214	CLIP-seq
MIRT2396350	hsa-miR-2278	CLIP-seq
MIRT2396351	hsa-miR-335	CLIP-seq
MIRT2396352	hsa-miR-424	CLIP-seq
MIRT1453778	hsa-miR-4459	CLIP-seq
MIRT2396353	hsa-miR-497	CLIP-seq

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0002039	Function	P53 binding	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 19249679, 21516116, 25416956, 31515488, 32296183, 36217030, 37671092
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005912	Component	Adherens junction	HDA	25468996
GO:0008270	Function	Zinc ion binding	IEA
GO:0042802	Function	Identical protein binding	IPI	16189514, 20211142, 32296183
GO:0045087	Process	Innate immune response	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098641	Function	Cadherin binding involved in cell-cell adhesion	HDA	25468996
GO:1900181	Process	Negative regulation of protein localization to nucleus	IEA

MIM	HGNC	e!Ensembl
610658	17274	ENSG00000137699

Q14134

Protein name

Tripartite motif-containing protein 29 (Ataxia telangiectasia group D-associated protein)

Protein function

Plays a crucial role in the regulation of macrophage activation in response to viral or bacterial infections within the respiratory tract. Mechanistically, TRIM29 interacts with IKBKG/NEMO in the lysosome where it induces its 'Lys-48' ubiquitina

PDB

2CSV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00643	zf-B_box	220 → 260	B-box zinc finger	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in placenta, prostate and thymus. {ECO:0000269|PubMed:11331580}.

Sequence

MEAADASRSNGSSPEARDARSPSGPSGSLENGTKADGKDAKTTNGHGGEAAEGKSLGSAL
KPGEGRSALFAGNEWRRPIIQFVESGDDKNSNYFSMDSMEGKRSPYAGLQLGAAKKPPVT
FAEKGELRKSIFSESRKPTVSIMEPGETRRNSYPRADTGLFSRSKSGSEEVLCDSCIGNK
QKAVKSCLVCQASFCELHLKPHLEGAAFRDHQLLEPIRDFEARKCPVHGKTMELFCQTDQ
TCICYLCMFQEHKNHSTVTVEEAKAEKETELSLQKEQLQLKIIEIEDEAEKWQKEKDRIK
SFTTNEKAILEQNFRDLVRDLEKQKEEVRAALEQREQDAVDQVKVIMDALDERAKVLHED
KQTREQLHSISDSVLFLQEFGALMSNYSLPPPLPTYHVLLEGEGLGQSLGNFKDDLLNVC
MRHVEKMCKADLSRNFIERNHMENGGDHRYVNNYTNSFGGEWSAPDTMKRYSMYLTPKGG
VRTSYQPSSPGRFTKETTQKNFNNLYGTKGNYTSRVWEYSSSIQNSDNDLPVVQGSSSFS
LKGYPSLMRSQSPKAQPQTWKSGKQTMLSHYRPFYVNKGNGIGSNEAP

Sequence length

588

Interactions

View interactions

	Reactome
			Interferon gamma signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINAL DETACHMENT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UVEAL MELANOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (73)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	22721621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	24864129		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24469230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	10719033, 19249679, 20368352, 24078150, 25593307, 30643195, 31168819, 8188213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	1609804	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	30389700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26471361, 26987391, 30643195, 31145890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16890201, 24950909, 27535224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22138580, 24950909, 27535224	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24651077, 28216417	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27081037, 33446568	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30566565	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26471361, 26987391, 30643195, 31145890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24864129	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22721621, 32640423	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GWASCAT_DG	22990015		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	15672406, 27081037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	15672406, 27081037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24078150, 30813948, 30881029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33495406, 37837384	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33824865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	30389700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	CTD_human_DG	30929997		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	22138580	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	24651077	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	24651077	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27535224	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30566565, 30876939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	30566565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22721621, 24864129, 27145374, 29693120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27081037, 33495406	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	CTD_human_DG	30929997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16890201, 24950909, 27535224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30566565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24651077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19249679, 24864129, 30389700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16890201, 24485335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26191199, 29556308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	28098872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26471361, 26987391, 30643195, 31145890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12057920, 16890201, 24078150, 24950909, 26987391, 27430345, 28098872, 29552313, 29556308, 30389700, 31168819, 31501523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	15672406, 27081037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24651077, 24950909, 27535224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33118318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
mixed gliomas	Glioma	CTD_human_DG	30929997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	26872369, 27145374, 29038422, 29693120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	27145374, 29693120, 37248790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15672406, 20083228, 22138580, 22721621, 24078150, 24651077, 24950909, 26191199, 26471361, 26872369, 27535224, 29556308, 29693120, 30643195, 30876939, 31048544 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	26872369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22721621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	22138580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28731167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33011193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	24864129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	24864129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24864129	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33011193, 33446568	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	31814890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	31048544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16890201, 24485335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12057920, 24485335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17448597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22721621, 23597566, 30389700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26191199, 29556308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26191199, 36876422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	32994394, 33318312	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	28098872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	28098872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28054302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23201130, 26987391, 30643195	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	26071105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27081037	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TRIM29 (tripartite motif containing 29)