NUP62 (nucleoporin 62)

Gene

• Entrez ID: 23636
• Gene name: Nucleoporin 62
• Gene symbol: NUP62
• Synonyms (NCBI Gene): IBSN, SNDI, p62
• Chromosome: 19
• Chromosome location: 19q13.33
• Summary: The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex i

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021011	hsa-miR-155-5p	Proteomics	18668040
MIRT021129	hsa-miR-186-5p	Sequencing	20371350
MIRT025574	hsa-miR-34a-5p	Sequencing	20371350
MIRT040077	hsa-miR-615-3p	CLASH	23622248
MIRT038819	hsa-miR-93-3p	CLASH	23622248
MIRT038643	hsa-miR-125a-3p	CLASH	23622248
MIRT036552	hsa-miR-1224-5p	CLASH	23622248
MIRT035782	hsa-miR-1914-5p	CLASH	23622248
MIRT674249	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT200694	hsa-miR-1913	HITS-CLIP	19536157
MIRT200692	hsa-miR-324-3p	HITS-CLIP	19536157
MIRT200691	hsa-miR-18a-3p	HITS-CLIP	19536157
MIRT674247	hsa-miR-6790-3p	HITS-CLIP	19536157
MIRT674246	hsa-miR-6821-3p	HITS-CLIP	19536157
MIRT674244	hsa-miR-4707-3p	HITS-CLIP	19536157
MIRT674242	hsa-miR-452-3p	HITS-CLIP	19536157
MIRT674241	hsa-miR-378a-5p	HITS-CLIP	19536157
MIRT674249	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT200694	hsa-miR-1913	HITS-CLIP	23824327
MIRT200692	hsa-miR-324-3p	HITS-CLIP	23824327
MIRT200691	hsa-miR-18a-3p	HITS-CLIP	23824327
MIRT674248	hsa-miR-3663-5p	HITS-CLIP	23824327
MIRT674247	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT674246	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT674245	hsa-miR-4755-3p	HITS-CLIP	23824327
MIRT674244	hsa-miR-4707-3p	HITS-CLIP	23824327
MIRT674243	hsa-miR-6131	HITS-CLIP	23824327
MIRT674242	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT674241	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT674240	hsa-miR-548s	HITS-CLIP	23824327
MIRT674239	hsa-miR-4701-5p	HITS-CLIP	23824327
MIRT674238	hsa-miR-588	HITS-CLIP	23824327
MIRT674237	hsa-miR-4435	HITS-CLIP	23824327
MIRT674236	hsa-miR-3187-3p	HITS-CLIP	23824327
MIRT674235	hsa-miR-6843-3p	HITS-CLIP	23824327
MIRT674234	hsa-miR-6848-3p	HITS-CLIP	23824327
MIRT503708	hsa-miR-495-3p	PAR-CLIP	23446348
MIRT503707	hsa-miR-5688	PAR-CLIP	23446348
MIRT503706	hsa-miR-4436b-3p	PAR-CLIP	23446348
MIRT503705	hsa-miR-4632-5p	PAR-CLIP	23446348
MIRT503704	hsa-miR-6735-5p	PAR-CLIP	23446348
MIRT503702	hsa-miR-6879-5p	PAR-CLIP	23446348
MIRT503703	hsa-miR-7843-5p	PAR-CLIP	23446348
MIRT503701	hsa-miR-3607-5p	PAR-CLIP	23446348
MIRT674249	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT200694	hsa-miR-1913	HITS-CLIP	19536157
MIRT200692	hsa-miR-324-3p	HITS-CLIP	19536157
MIRT200691	hsa-miR-18a-3p	HITS-CLIP	19536157
MIRT674247	hsa-miR-6790-3p	HITS-CLIP	19536157
MIRT674246	hsa-miR-6821-3p	HITS-CLIP	19536157
MIRT674244	hsa-miR-4707-3p	HITS-CLIP	19536157
MIRT674242	hsa-miR-452-3p	HITS-CLIP	19536157
MIRT674241	hsa-miR-378a-5p	HITS-CLIP	19536157
MIRT674249	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT200694	hsa-miR-1913	HITS-CLIP	23824327
MIRT200692	hsa-miR-324-3p	HITS-CLIP	23824327
MIRT200691	hsa-miR-18a-3p	HITS-CLIP	23824327
MIRT674248	hsa-miR-3663-5p	HITS-CLIP	23824327
MIRT674247	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT674246	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT674245	hsa-miR-4755-3p	HITS-CLIP	23824327
MIRT674244	hsa-miR-4707-3p	HITS-CLIP	23824327
MIRT674243	hsa-miR-6131	HITS-CLIP	23824327
MIRT674242	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT674241	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT674240	hsa-miR-548s	HITS-CLIP	23824327
MIRT674239	hsa-miR-4701-5p	HITS-CLIP	23824327
MIRT674238	hsa-miR-588	HITS-CLIP	23824327
MIRT674237	hsa-miR-4435	HITS-CLIP	23824327
MIRT674236	hsa-miR-3187-3p	HITS-CLIP	23824327
MIRT674235	hsa-miR-6843-3p	HITS-CLIP	23824327
MIRT674234	hsa-miR-6848-3p	HITS-CLIP	23824327
MIRT503708	hsa-miR-495-3p	PAR-CLIP	23446348
MIRT503707	hsa-miR-5688	PAR-CLIP	23446348
MIRT503706	hsa-miR-4436b-3p	PAR-CLIP	23446348
MIRT503705	hsa-miR-4632-5p	PAR-CLIP	23446348
MIRT503704	hsa-miR-6735-5p	PAR-CLIP	23446348
MIRT503702	hsa-miR-6879-5p	PAR-CLIP	23446348
MIRT503703	hsa-miR-7843-5p	PAR-CLIP	23446348
MIRT503701	hsa-miR-3607-5p	PAR-CLIP	23446348
MIRT1199694	hsa-miR-105	CLIP-seq
MIRT1199695	hsa-miR-1227	CLIP-seq
MIRT1199696	hsa-miR-1343	CLIP-seq
MIRT1199697	hsa-miR-3136-3p	CLIP-seq
MIRT1199698	hsa-miR-3148	CLIP-seq
MIRT1199699	hsa-miR-3155	CLIP-seq
MIRT1199700	hsa-miR-3155b	CLIP-seq
MIRT1199701	hsa-miR-330-3p	CLIP-seq
MIRT1199702	hsa-miR-337-5p	CLIP-seq
MIRT1199703	hsa-miR-3646	CLIP-seq
MIRT1199704	hsa-miR-3688-3p	CLIP-seq
MIRT1199705	hsa-miR-3689d	CLIP-seq
MIRT1199706	hsa-miR-3690	CLIP-seq
MIRT1199707	hsa-miR-4254	CLIP-seq
MIRT1199708	hsa-miR-4316	CLIP-seq
MIRT1199709	hsa-miR-4438	CLIP-seq
MIRT1199710	hsa-miR-4646-5p	CLIP-seq
MIRT1199711	hsa-miR-4667-3p	CLIP-seq
MIRT1199712	hsa-miR-4694-3p	CLIP-seq
MIRT1199713	hsa-miR-4710	CLIP-seq
MIRT1199714	hsa-miR-4715-3p	CLIP-seq
MIRT1199715	hsa-miR-4747-5p	CLIP-seq
MIRT1199716	hsa-miR-4761-5p	CLIP-seq
MIRT1199717	hsa-miR-4786-3p	CLIP-seq
MIRT1199718	hsa-miR-484	CLIP-seq
MIRT1199719	hsa-miR-5095	CLIP-seq
MIRT1199720	hsa-miR-516a-3p	CLIP-seq
MIRT1199721	hsa-miR-522	CLIP-seq
MIRT1199722	hsa-miR-621	CLIP-seq
MIRT1199723	hsa-miR-765	CLIP-seq
MIRT1199724	hsa-miR-888	CLIP-seq
MIRT1199725	hsa-miR-101	CLIP-seq
MIRT1199726	hsa-miR-1254	CLIP-seq
MIRT1199727	hsa-miR-1285	CLIP-seq
MIRT1199728	hsa-miR-1292	CLIP-seq
MIRT1199696	hsa-miR-1343	CLIP-seq
MIRT1199729	hsa-miR-142-5p	CLIP-seq
MIRT1199730	hsa-miR-144	CLIP-seq
MIRT1199731	hsa-miR-193a-5p	CLIP-seq
MIRT1199732	hsa-miR-197	CLIP-seq
MIRT1199733	hsa-miR-1976	CLIP-seq
MIRT1199734	hsa-miR-2116	CLIP-seq
MIRT1199735	hsa-miR-2467-5p	CLIP-seq
MIRT1199736	hsa-miR-298	CLIP-seq
MIRT1199737	hsa-miR-3116	CLIP-seq
MIRT1199738	hsa-miR-3123	CLIP-seq
MIRT1199739	hsa-miR-3144-5p	CLIP-seq
MIRT1199740	hsa-miR-3187-5p	CLIP-seq
MIRT1199741	hsa-miR-3188	CLIP-seq
MIRT1199742	hsa-miR-3191	CLIP-seq
MIRT1199743	hsa-miR-3192	CLIP-seq
MIRT1199744	hsa-miR-331-5p	CLIP-seq
MIRT1199745	hsa-miR-340	CLIP-seq
MIRT1199746	hsa-miR-378g	CLIP-seq
MIRT1199747	hsa-miR-3919	CLIP-seq
MIRT1199748	hsa-miR-3942-3p	CLIP-seq
MIRT1199749	hsa-miR-3973	CLIP-seq
MIRT1199750	hsa-miR-3975	CLIP-seq
MIRT1199751	hsa-miR-4273	CLIP-seq
MIRT1199752	hsa-miR-4289	CLIP-seq
MIRT1199753	hsa-miR-4291	CLIP-seq
MIRT1199754	hsa-miR-4471	CLIP-seq
MIRT1199755	hsa-miR-4492	CLIP-seq
MIRT1199756	hsa-miR-4493	CLIP-seq
MIRT1199757	hsa-miR-4498	CLIP-seq
MIRT1199758	hsa-miR-4501	CLIP-seq
MIRT1199759	hsa-miR-4504	CLIP-seq
MIRT1199760	hsa-miR-4505	CLIP-seq
MIRT1199761	hsa-miR-4641	CLIP-seq
MIRT1199762	hsa-miR-4652-5p	CLIP-seq
MIRT1199763	hsa-miR-4667-5p	CLIP-seq
MIRT1199764	hsa-miR-4677-5p	CLIP-seq
MIRT1199765	hsa-miR-4678	CLIP-seq
MIRT1199766	hsa-miR-4700-5p	CLIP-seq
MIRT1199767	hsa-miR-4716-5p	CLIP-seq
MIRT1199768	hsa-miR-4729	CLIP-seq
MIRT1199769	hsa-miR-4731-5p	CLIP-seq
MIRT1199770	hsa-miR-4756-3p	CLIP-seq
MIRT1199771	hsa-miR-4781-3p	CLIP-seq
MIRT1199717	hsa-miR-4786-3p	CLIP-seq
MIRT1199772	hsa-miR-483-5p	CLIP-seq
MIRT1199773	hsa-miR-485-5p	CLIP-seq
MIRT1199774	hsa-miR-495	CLIP-seq
MIRT1199775	hsa-miR-5096	CLIP-seq
MIRT1199776	hsa-miR-542-3p	CLIP-seq
MIRT1199777	hsa-miR-545	CLIP-seq
MIRT1199778	hsa-miR-548l	CLIP-seq
MIRT1199779	hsa-miR-548u	CLIP-seq
MIRT1199780	hsa-miR-579	CLIP-seq
MIRT1199781	hsa-miR-593	CLIP-seq
MIRT1199782	hsa-miR-602	CLIP-seq
MIRT1199783	hsa-miR-612	CLIP-seq
MIRT1199784	hsa-miR-661	CLIP-seq
MIRT1199785	hsa-miR-762	CLIP-seq
MIRT1199695	hsa-miR-1227	CLIP-seq
MIRT1199786	hsa-miR-128	CLIP-seq
MIRT1199787	hsa-miR-1290	CLIP-seq
MIRT1199728	hsa-miR-1292	CLIP-seq
MIRT1199696	hsa-miR-1343	CLIP-seq
MIRT1199731	hsa-miR-193a-5p	CLIP-seq
MIRT1199732	hsa-miR-197	CLIP-seq
MIRT1199733	hsa-miR-1976	CLIP-seq
MIRT1199734	hsa-miR-2116	CLIP-seq
MIRT1199788	hsa-miR-3064-3p	CLIP-seq
MIRT1199697	hsa-miR-3136-3p	CLIP-seq
MIRT1199739	hsa-miR-3144-5p	CLIP-seq
MIRT1199789	hsa-miR-3149	CLIP-seq
MIRT1199790	hsa-miR-3167	CLIP-seq
MIRT1199742	hsa-miR-3191	CLIP-seq
MIRT1199743	hsa-miR-3192	CLIP-seq
MIRT1199791	hsa-miR-323-5p	CLIP-seq
MIRT1199702	hsa-miR-337-5p	CLIP-seq
MIRT1199792	hsa-miR-342-3p	CLIP-seq
MIRT1199793	hsa-miR-3681	CLIP-seq
MIRT1199705	hsa-miR-3689d	CLIP-seq
MIRT1199706	hsa-miR-3690	CLIP-seq
MIRT1199794	hsa-miR-3691-3p	CLIP-seq
MIRT1199795	hsa-miR-3692	CLIP-seq
MIRT1199746	hsa-miR-378g	CLIP-seq
MIRT1199796	hsa-miR-3929	CLIP-seq
MIRT1199797	hsa-miR-411	CLIP-seq
MIRT1199798	hsa-miR-4252	CLIP-seq
MIRT1199707	hsa-miR-4254	CLIP-seq
MIRT1199751	hsa-miR-4273	CLIP-seq
MIRT1199752	hsa-miR-4289	CLIP-seq
MIRT1199799	hsa-miR-4297	CLIP-seq
MIRT1199800	hsa-miR-4299	CLIP-seq
MIRT1199708	hsa-miR-4316	CLIP-seq
MIRT1199801	hsa-miR-4419b	CLIP-seq
MIRT1199802	hsa-miR-4447	CLIP-seq
MIRT1199803	hsa-miR-4456	CLIP-seq
MIRT1199804	hsa-miR-4457	CLIP-seq
MIRT1199805	hsa-miR-4472	CLIP-seq
MIRT1199806	hsa-miR-4478	CLIP-seq
MIRT1199807	hsa-miR-4480	CLIP-seq
MIRT1199755	hsa-miR-4492	CLIP-seq
MIRT1199757	hsa-miR-4498	CLIP-seq
MIRT1199758	hsa-miR-4501	CLIP-seq
MIRT1199759	hsa-miR-4504	CLIP-seq
MIRT1199760	hsa-miR-4505	CLIP-seq
MIRT1199808	hsa-miR-450b-3p	CLIP-seq
MIRT1199809	hsa-miR-4640-5p	CLIP-seq
MIRT1199761	hsa-miR-4641	CLIP-seq
MIRT1199810	hsa-miR-4645-5p	CLIP-seq
MIRT1199762	hsa-miR-4652-5p	CLIP-seq
MIRT1199763	hsa-miR-4667-5p	CLIP-seq
MIRT1199811	hsa-miR-4673	CLIP-seq
MIRT1199764	hsa-miR-4677-5p	CLIP-seq
MIRT1199766	hsa-miR-4700-5p	CLIP-seq
MIRT1199713	hsa-miR-4710	CLIP-seq
MIRT1199714	hsa-miR-4715-3p	CLIP-seq
MIRT1199767	hsa-miR-4716-5p	CLIP-seq
MIRT1199812	hsa-miR-4726-5p	CLIP-seq
MIRT1199813	hsa-miR-4727-5p	CLIP-seq
MIRT1199768	hsa-miR-4729	CLIP-seq
MIRT1199769	hsa-miR-4731-5p	CLIP-seq
MIRT1199814	hsa-miR-4742-5p	CLIP-seq
MIRT1199715	hsa-miR-4747-5p	CLIP-seq
MIRT1199716	hsa-miR-4761-5p	CLIP-seq
MIRT1199771	hsa-miR-4781-3p	CLIP-seq
MIRT1199815	hsa-miR-4792	CLIP-seq
MIRT1199772	hsa-miR-483-5p	CLIP-seq
MIRT1199774	hsa-miR-495	CLIP-seq
MIRT1199775	hsa-miR-5096	CLIP-seq
MIRT1199816	hsa-miR-513b	CLIP-seq
MIRT1199720	hsa-miR-516a-3p	CLIP-seq
MIRT1199776	hsa-miR-542-3p	CLIP-seq
MIRT1199817	hsa-miR-548q	CLIP-seq
MIRT1199780	hsa-miR-579	CLIP-seq
MIRT1199781	hsa-miR-593	CLIP-seq
MIRT1199782	hsa-miR-602	CLIP-seq
MIRT1199722	hsa-miR-621	CLIP-seq
MIRT1199818	hsa-miR-626	CLIP-seq
MIRT1199819	hsa-miR-645	CLIP-seq
MIRT1199784	hsa-miR-661	CLIP-seq
MIRT1199785	hsa-miR-762	CLIP-seq
MIRT1199723	hsa-miR-765	CLIP-seq
MIRT1199820	hsa-miR-769-3p	CLIP-seq
MIRT1199821	hsa-miR-876-5p	CLIP-seq
MIRT2057873	hsa-miR-122	CLIP-seq
MIRT2057874	hsa-miR-1226	CLIP-seq
MIRT2057875	hsa-miR-1228	CLIP-seq
MIRT2057876	hsa-miR-1255b	CLIP-seq
MIRT2057877	hsa-miR-1270	CLIP-seq
MIRT2057878	hsa-miR-1307	CLIP-seq
MIRT2057879	hsa-miR-136	CLIP-seq
MIRT2057880	hsa-miR-1469	CLIP-seq
MIRT2057881	hsa-miR-185	CLIP-seq
MIRT2057882	hsa-miR-302a	CLIP-seq
MIRT2057883	hsa-miR-302b	CLIP-seq
MIRT2057884	hsa-miR-302c	CLIP-seq
MIRT2057885	hsa-miR-302d	CLIP-seq
MIRT2057886	hsa-miR-302e	CLIP-seq
MIRT2057887	hsa-miR-3135	CLIP-seq
MIRT2057888	hsa-miR-3135b	CLIP-seq
MIRT1199739	hsa-miR-3144-5p	CLIP-seq
MIRT1199789	hsa-miR-3149	CLIP-seq
MIRT1199742	hsa-miR-3191	CLIP-seq
MIRT1199791	hsa-miR-323-5p	CLIP-seq
MIRT2057889	hsa-miR-3615	CLIP-seq
MIRT2057890	hsa-miR-3622a-3p	CLIP-seq
MIRT2057891	hsa-miR-3622b-3p	CLIP-seq
MIRT2057892	hsa-miR-3650	CLIP-seq
MIRT2057893	hsa-miR-3652	CLIP-seq
MIRT2057894	hsa-miR-372	CLIP-seq
MIRT2057895	hsa-miR-373	CLIP-seq
MIRT1199796	hsa-miR-3929	CLIP-seq
MIRT1199798	hsa-miR-4252	CLIP-seq
MIRT2057896	hsa-miR-4306	CLIP-seq
MIRT1199801	hsa-miR-4419b	CLIP-seq
MIRT2057897	hsa-miR-4420	CLIP-seq
MIRT2057898	hsa-miR-4430	CLIP-seq
MIRT1199806	hsa-miR-4478	CLIP-seq
MIRT1199755	hsa-miR-4492	CLIP-seq
MIRT1199757	hsa-miR-4498	CLIP-seq
MIRT1199758	hsa-miR-4501	CLIP-seq
MIRT1199759	hsa-miR-4504	CLIP-seq
MIRT1199760	hsa-miR-4505	CLIP-seq
MIRT2057899	hsa-miR-4531	CLIP-seq
MIRT2057900	hsa-miR-4638-5p	CLIP-seq
MIRT2057901	hsa-miR-4644	CLIP-seq
MIRT2057902	hsa-miR-4650-5p	CLIP-seq
MIRT1199762	hsa-miR-4652-5p	CLIP-seq
MIRT2057903	hsa-miR-4663	CLIP-seq
MIRT1199763	hsa-miR-4667-5p	CLIP-seq
MIRT1199765	hsa-miR-4678	CLIP-seq
MIRT2057904	hsa-miR-4693-3p	CLIP-seq
MIRT1199766	hsa-miR-4700-5p	CLIP-seq
MIRT1199769	hsa-miR-4731-5p	CLIP-seq
MIRT2057905	hsa-miR-4732-3p	CLIP-seq
MIRT2057906	hsa-miR-4733-3p	CLIP-seq
MIRT2057907	hsa-miR-4757-5p	CLIP-seq
MIRT2057908	hsa-miR-4772-3p	CLIP-seq
MIRT2057909	hsa-miR-4774-3p	CLIP-seq
MIRT1199815	hsa-miR-4792	CLIP-seq
MIRT2057910	hsa-miR-512-3p	CLIP-seq
MIRT2057911	hsa-miR-515-5p	CLIP-seq
MIRT2057912	hsa-miR-520a-3p	CLIP-seq
MIRT2057913	hsa-miR-520b	CLIP-seq
MIRT2057914	hsa-miR-520c-3p	CLIP-seq
MIRT2057915	hsa-miR-520d-3p	CLIP-seq
MIRT2057916	hsa-miR-520e	CLIP-seq
MIRT1199776	hsa-miR-542-3p	CLIP-seq
MIRT1199782	hsa-miR-602	CLIP-seq
MIRT2057917	hsa-miR-620	CLIP-seq
MIRT1199819	hsa-miR-645	CLIP-seq
MIRT2057918	hsa-miR-659	CLIP-seq
MIRT1199785	hsa-miR-762	CLIP-seq
MIRT2286221	hsa-miR-1183	CLIP-seq
MIRT2286222	hsa-miR-1269	CLIP-seq
MIRT2286223	hsa-miR-1269b	CLIP-seq
MIRT2286224	hsa-miR-1288	CLIP-seq
MIRT2057887	hsa-miR-3135	CLIP-seq
MIRT2286225	hsa-miR-3138	CLIP-seq
MIRT2286226	hsa-miR-4461	CLIP-seq
MIRT2286227	hsa-miR-4515	CLIP-seq
MIRT2286228	hsa-miR-4693-5p	CLIP-seq
MIRT2286229	hsa-miR-4696	CLIP-seq
MIRT2286230	hsa-miR-4740-5p	CLIP-seq
MIRT2286231	hsa-miR-4800-5p	CLIP-seq
MIRT2286232	hsa-miR-940	CLIP-seq
MIRT2057873	hsa-miR-122	CLIP-seq
MIRT2057887	hsa-miR-3135	CLIP-seq
MIRT2057888	hsa-miR-3135b	CLIP-seq
MIRT2057892	hsa-miR-3650	CLIP-seq
MIRT2057893	hsa-miR-3652	CLIP-seq
MIRT1199796	hsa-miR-3929	CLIP-seq
MIRT1199801	hsa-miR-4419b	CLIP-seq
MIRT2057898	hsa-miR-4430	CLIP-seq
MIRT1199806	hsa-miR-4478	CLIP-seq
MIRT2057903	hsa-miR-4663	CLIP-seq
MIRT2286233	hsa-miR-4680-5p	CLIP-seq
MIRT2057909	hsa-miR-4774-3p	CLIP-seq
MIRT1199819	hsa-miR-645	CLIP-seq
MIRT2057918	hsa-miR-659	CLIP-seq
MIRT1199796	hsa-miR-3929	CLIP-seq
MIRT1199801	hsa-miR-4419b	CLIP-seq
MIRT1199806	hsa-miR-4478	CLIP-seq
MIRT2286233	hsa-miR-4680-5p	CLIP-seq
MIRT2057873	hsa-miR-122	CLIP-seq
MIRT2455557	hsa-miR-3064-5p	CLIP-seq
MIRT2057887	hsa-miR-3135	CLIP-seq
MIRT2057888	hsa-miR-3135b	CLIP-seq
MIRT2057893	hsa-miR-3652	CLIP-seq
MIRT1199796	hsa-miR-3929	CLIP-seq
MIRT2455558	hsa-miR-4313	CLIP-seq
MIRT1199801	hsa-miR-4419b	CLIP-seq
MIRT2057898	hsa-miR-4430	CLIP-seq
MIRT1199806	hsa-miR-4478	CLIP-seq
MIRT1199760	hsa-miR-4505	CLIP-seq
MIRT2455559	hsa-miR-4725-5p	CLIP-seq
MIRT2057909	hsa-miR-4774-3p	CLIP-seq
MIRT2455560	hsa-miR-504	CLIP-seq
MIRT1199781	hsa-miR-593	CLIP-seq
MIRT2455561	hsa-miR-604	CLIP-seq
MIRT1199819	hsa-miR-645	CLIP-seq
MIRT2455562	hsa-miR-647	CLIP-seq
MIRT1199694	hsa-miR-105	CLIP-seq
MIRT2057873	hsa-miR-122	CLIP-seq
MIRT2057874	hsa-miR-1226	CLIP-seq
MIRT2057875	hsa-miR-1228	CLIP-seq
MIRT2057876	hsa-miR-1255b	CLIP-seq
MIRT2584140	hsa-miR-1266	CLIP-seq
MIRT2057877	hsa-miR-1270	CLIP-seq
MIRT1199696	hsa-miR-1343	CLIP-seq
MIRT2057879	hsa-miR-136	CLIP-seq
MIRT2057881	hsa-miR-185	CLIP-seq
MIRT2584141	hsa-miR-1915	CLIP-seq
MIRT1199733	hsa-miR-1976	CLIP-seq
MIRT2584142	hsa-miR-2276	CLIP-seq
MIRT2584143	hsa-miR-24	CLIP-seq
MIRT2584144	hsa-miR-296-5p	CLIP-seq
MIRT2455557	hsa-miR-3064-5p	CLIP-seq
MIRT2584145	hsa-miR-3065-3p	CLIP-seq
MIRT2057887	hsa-miR-3135	CLIP-seq
MIRT2057888	hsa-miR-3135b	CLIP-seq
MIRT1199697	hsa-miR-3136-3p	CLIP-seq
MIRT1199739	hsa-miR-3144-5p	CLIP-seq
MIRT1199789	hsa-miR-3149	CLIP-seq
MIRT1199699	hsa-miR-3155	CLIP-seq
MIRT1199700	hsa-miR-3155b	CLIP-seq
MIRT1199743	hsa-miR-3192	CLIP-seq
MIRT1199791	hsa-miR-323-5p	CLIP-seq
MIRT2057890	hsa-miR-3622a-3p	CLIP-seq
MIRT2057891	hsa-miR-3622b-3p	CLIP-seq
MIRT1199703	hsa-miR-3646	CLIP-seq
MIRT2584146	hsa-miR-3649	CLIP-seq
MIRT2057892	hsa-miR-3650	CLIP-seq
MIRT2057893	hsa-miR-3652	CLIP-seq
MIRT1199705	hsa-miR-3689d	CLIP-seq
MIRT1199706	hsa-miR-3690	CLIP-seq
MIRT2584147	hsa-miR-3714	CLIP-seq
MIRT1199796	hsa-miR-3929	CLIP-seq
MIRT1199707	hsa-miR-4254	CLIP-seq
MIRT2057896	hsa-miR-4306	CLIP-seq
MIRT2455558	hsa-miR-4313	CLIP-seq
MIRT1199708	hsa-miR-4316	CLIP-seq
MIRT1199801	hsa-miR-4419b	CLIP-seq
MIRT2057898	hsa-miR-4430	CLIP-seq
MIRT1199709	hsa-miR-4438	CLIP-seq
MIRT2584148	hsa-miR-4446-3p	CLIP-seq
MIRT1199802	hsa-miR-4447	CLIP-seq
MIRT1199805	hsa-miR-4472	CLIP-seq
MIRT1199806	hsa-miR-4478	CLIP-seq
MIRT1199756	hsa-miR-4493	CLIP-seq
MIRT1199760	hsa-miR-4505	CLIP-seq
MIRT2584149	hsa-miR-4518	CLIP-seq
MIRT2057899	hsa-miR-4531	CLIP-seq
MIRT1199809	hsa-miR-4640-5p	CLIP-seq
MIRT2057901	hsa-miR-4644	CLIP-seq
MIRT1199810	hsa-miR-4645-5p	CLIP-seq
MIRT1199710	hsa-miR-4646-5p	CLIP-seq
MIRT2057903	hsa-miR-4663	CLIP-seq
MIRT1199811	hsa-miR-4673	CLIP-seq
MIRT2286233	hsa-miR-4680-5p	CLIP-seq
MIRT2584150	hsa-miR-4685-5p	CLIP-seq
MIRT2057904	hsa-miR-4693-3p	CLIP-seq
MIRT2286229	hsa-miR-4696	CLIP-seq
MIRT1199713	hsa-miR-4710	CLIP-seq
MIRT1199714	hsa-miR-4715-3p	CLIP-seq
MIRT2584151	hsa-miR-4717-5p	CLIP-seq
MIRT2455559	hsa-miR-4725-5p	CLIP-seq
MIRT1199812	hsa-miR-4726-5p	CLIP-seq
MIRT2057906	hsa-miR-4733-3p	CLIP-seq
MIRT2584152	hsa-miR-4734	CLIP-seq
MIRT2584153	hsa-miR-4735-5p	CLIP-seq
MIRT1199814	hsa-miR-4742-5p	CLIP-seq
MIRT1199715	hsa-miR-4747-5p	CLIP-seq
MIRT2584154	hsa-miR-4753-5p	CLIP-seq
MIRT1199716	hsa-miR-4761-5p	CLIP-seq
MIRT2584155	hsa-miR-4767	CLIP-seq
MIRT2057909	hsa-miR-4774-3p	CLIP-seq
MIRT2584156	hsa-miR-4775	CLIP-seq
MIRT1199815	hsa-miR-4792	CLIP-seq
MIRT1199718	hsa-miR-484	CLIP-seq
MIRT2584157	hsa-miR-492	CLIP-seq
MIRT2455560	hsa-miR-504	CLIP-seq
MIRT1199719	hsa-miR-5095	CLIP-seq
MIRT2057911	hsa-miR-515-5p	CLIP-seq
MIRT1199720	hsa-miR-516a-3p	CLIP-seq
MIRT2584158	hsa-miR-548an	CLIP-seq
MIRT2584159	hsa-miR-590-3p	CLIP-seq
MIRT1199781	hsa-miR-593	CLIP-seq
MIRT2455561	hsa-miR-604	CLIP-seq
MIRT2057917	hsa-miR-620	CLIP-seq
MIRT1199818	hsa-miR-626	CLIP-seq
MIRT1199819	hsa-miR-645	CLIP-seq
MIRT2455562	hsa-miR-647	CLIP-seq
MIRT1199784	hsa-miR-661	CLIP-seq
MIRT1199723	hsa-miR-765	CLIP-seq
MIRT1199724	hsa-miR-888	CLIP-seq
MIRT2286232	hsa-miR-940	CLIP-seq
MIRT2057873	hsa-miR-122	CLIP-seq
MIRT2057874	hsa-miR-1226	CLIP-seq
MIRT2057875	hsa-miR-1228	CLIP-seq
MIRT2057876	hsa-miR-1255b	CLIP-seq
MIRT2584140	hsa-miR-1266	CLIP-seq
MIRT2057877	hsa-miR-1270	CLIP-seq
MIRT1199696	hsa-miR-1343	CLIP-seq
MIRT2057879	hsa-miR-136	CLIP-seq
MIRT2057881	hsa-miR-185	CLIP-seq
MIRT1199733	hsa-miR-1976	CLIP-seq
MIRT2584142	hsa-miR-2276	CLIP-seq
MIRT2584143	hsa-miR-24	CLIP-seq
MIRT2455557	hsa-miR-3064-5p	CLIP-seq
MIRT2584145	hsa-miR-3065-3p	CLIP-seq
MIRT2057887	hsa-miR-3135	CLIP-seq
MIRT2057888	hsa-miR-3135b	CLIP-seq
MIRT1199697	hsa-miR-3136-3p	CLIP-seq
MIRT1199739	hsa-miR-3144-5p	CLIP-seq
MIRT1199789	hsa-miR-3149	CLIP-seq
MIRT1199699	hsa-miR-3155	CLIP-seq
MIRT1199700	hsa-miR-3155b	CLIP-seq
MIRT1199743	hsa-miR-3192	CLIP-seq
MIRT1199791	hsa-miR-323-5p	CLIP-seq
MIRT2057890	hsa-miR-3622a-3p	CLIP-seq
MIRT2057891	hsa-miR-3622b-3p	CLIP-seq
MIRT2584146	hsa-miR-3649	CLIP-seq
MIRT2057892	hsa-miR-3650	CLIP-seq
MIRT2057893	hsa-miR-3652	CLIP-seq
MIRT1199705	hsa-miR-3689d	CLIP-seq
MIRT1199706	hsa-miR-3690	CLIP-seq
MIRT1199796	hsa-miR-3929	CLIP-seq
MIRT1199707	hsa-miR-4254	CLIP-seq
MIRT2057896	hsa-miR-4306	CLIP-seq
MIRT2455558	hsa-miR-4313	CLIP-seq
MIRT1199708	hsa-miR-4316	CLIP-seq
MIRT1199801	hsa-miR-4419b	CLIP-seq
MIRT2057898	hsa-miR-4430	CLIP-seq
MIRT1199709	hsa-miR-4438	CLIP-seq
MIRT1199802	hsa-miR-4447	CLIP-seq
MIRT1199805	hsa-miR-4472	CLIP-seq
MIRT1199806	hsa-miR-4478	CLIP-seq
MIRT1199756	hsa-miR-4493	CLIP-seq
MIRT1199760	hsa-miR-4505	CLIP-seq
MIRT2584149	hsa-miR-4518	CLIP-seq
MIRT2057899	hsa-miR-4531	CLIP-seq
MIRT2057901	hsa-miR-4644	CLIP-seq
MIRT1199710	hsa-miR-4646-5p	CLIP-seq
MIRT2057903	hsa-miR-4663	CLIP-seq
MIRT2286233	hsa-miR-4680-5p	CLIP-seq
MIRT2057904	hsa-miR-4693-3p	CLIP-seq
MIRT2286229	hsa-miR-4696	CLIP-seq
MIRT1199713	hsa-miR-4710	CLIP-seq
MIRT1199714	hsa-miR-4715-3p	CLIP-seq
MIRT2584151	hsa-miR-4717-5p	CLIP-seq
MIRT2455559	hsa-miR-4725-5p	CLIP-seq
MIRT2057906	hsa-miR-4733-3p	CLIP-seq
MIRT2584153	hsa-miR-4735-5p	CLIP-seq
MIRT1199715	hsa-miR-4747-5p	CLIP-seq
MIRT2584154	hsa-miR-4753-5p	CLIP-seq
MIRT1199716	hsa-miR-4761-5p	CLIP-seq
MIRT2057909	hsa-miR-4774-3p	CLIP-seq
MIRT2584156	hsa-miR-4775	CLIP-seq
MIRT1199815	hsa-miR-4792	CLIP-seq
MIRT1199718	hsa-miR-484	CLIP-seq
MIRT2584157	hsa-miR-492	CLIP-seq
MIRT2455560	hsa-miR-504	CLIP-seq
MIRT1199719	hsa-miR-5095	CLIP-seq
MIRT2057911	hsa-miR-515-5p	CLIP-seq
MIRT1199720	hsa-miR-516a-3p	CLIP-seq
MIRT2584159	hsa-miR-590-3p	CLIP-seq
MIRT2455561	hsa-miR-604	CLIP-seq
MIRT2057917	hsa-miR-620	CLIP-seq
MIRT1199818	hsa-miR-626	CLIP-seq
MIRT1199819	hsa-miR-645	CLIP-seq
MIRT2455562	hsa-miR-647	CLIP-seq
MIRT1199723	hsa-miR-765	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000922	Component	Spindle pole	IDA	24107630
GO:0000922	Component	Spindle pole	IEA
GO:0003682	Function	Chromatin binding	NAS
GO:0005515	Function	Protein binding	IPI	7744965, 15953362, 16189514, 16648475, 18266911, 18596238, 21078624, 21516116, 22334672, 23477864, 23652018, 24107630, 25416956, 25544563, 25910212, 26496610, 26871637, 27194810, 28514442, 29892012, 30543681, 31515488, 32296183, 33961781
GO:0005543	Function	Phospholipid binding	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IDA	17098863, 24107630, 24315095
GO:0005635	Component	Nuclear envelope	IEA
GO:0005635	Component	Nuclear envelope	TAS
GO:0005643	Component	Nuclear pore	IDA	1915414, 23777819
GO:0005643	Component	Nuclear pore	IEA
GO:0005643	Component	Nuclear pore	NAS	24315095
GO:0005643	Component	Nuclear pore	TAS	1915414
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	24107630
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS
GO:0005813	Component	Centrosome	IDA	24107630
GO:0005813	Component	Centrosome	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006405	Process	RNA export from nucleus	IBA
GO:0006606	Process	Protein import into nucleus	IBA
GO:0006913	Process	Nucleocytoplasmic transport	NAS	27016207
GO:0007080	Process	Mitotic metaphase chromosome alignment	IMP	24107630
GO:0007098	Process	Centrosome cycle	IMP	24107630
GO:0007100	Process	Mitotic centrosome separation	IMP	24107630
GO:0007166	Process	Cell surface receptor signaling pathway	IDA	10799545
GO:0007166	Process	Cell surface receptor signaling pathway	NAS
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	11013214
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0009966	Process	Regulation of signal transduction	NAS
GO:0015031	Process	Protein transport	IEA
GO:0017056	Function	Structural constituent of nuclear pore	IBA
GO:0017056	Function	Structural constituent of nuclear pore	IEA
GO:0030159	Function	Signaling receptor complex adaptor activity	IDA
GO:0030544	Function	Hsp70 protein binding	IEA
GO:0031965	Component	Nuclear membrane	IDA
GO:0031965	Component	Nuclear membrane	IEA
GO:0042059	Process	Negative regulation of epidermal growth factor receptor signaling pathway	IEA
GO:0042169	Function	SH2 domain binding	IDA
GO:0043066	Process	Negative regulation of apoptotic process	IDA
GO:0043069	Process	Negative regulation of programmed cell death	IDA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA
GO:0043130	Function	Ubiquitin binding	IDA
GO:0044613	Component	Nuclear pore central transport channel	IBA
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	NAS
GO:0045840	Process	Positive regulation of mitotic nuclear division	IMP	24107630
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA
GO:0046578	Process	Regulation of Ras protein signal transduction	NAS	11553620
GO:0046580	Process	Negative regulation of Ras protein signal transduction	IEA
GO:0046601	Process	Positive regulation of centriole replication	IMP	24107630
GO:0051028	Process	MRNA transport	IEA
GO:0051425	Function	PTB domain binding	IEA
GO:0051879	Function	Hsp90 protein binding	IEA
GO:0060236	Process	Regulation of mitotic spindle organization	IMP	24107630
GO:0072686	Component	Mitotic spindle	IDA	24107630
GO:0090398	Process	Cellular senescence	IEA
GO:0090543	Component	Flemming body	IDA	19166812
GO:0098534	Process	Centriole assembly	IMP	24107630
GO:1903438	Process	Positive regulation of mitotic cytokinetic process	IMP	24107630
GO:1904781	Process	Positive regulation of protein localization to centrosome	IMP	24107630
GO:1990904	Component	Ribonucleoprotein complex	IDA	18809582

Other IDs

• MIM: 605815
• HGNC: 8066
• e!Ensembl: ENSG00000213024

Protein

• UniProt ID: P37198
• Protein name: Nuclear pore glycoprotein p62 (62 kDa nucleoporin) (Nucleoporin Nup62)
• Protein function: Essential component of the nuclear pore complex (PubMed:1915414). The N-terminal is probably involved in nucleocytoplasmic transport (PubMed:1915414). The C-terminal is involved in protein-protein interaction probably via coiled-coil formation,
• PDB: 5IJN, 5IJO, 7PER, 7R5J, 7R5K
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05064	Nsp1_C	317 → 429	Nsp1-like C-terminal region	Family

• Sequence:

  MSGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPATSTPSTGLF
  SLATQTPATQTTGFTFGTATLASGGTGFSLGIGASKLNLSNTAATPAMANPSGFGLGSSN
  LTNAISSTVTSSQGTAPTGFVFGPSTTSVAPATTSGGFSFTGGSTAQPSGFNIGSAGNSA
  QPTAPATLPFTPATPAATTAGATQPAAPTPTATITSTGPSLFASIATAPTSSATTGLSLC
  TPVTTAGAPTAGTQGFSLKAPGAASGTSTTTSTAATATATTTSSSSTTGFALNLKPLAPA
  GIPSNTAAAVTAPPGPGAAAGAAASSAMTYAQLESLINKWSLELEDQERHFLQQATQVNA
  WDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGT
  IYLQHADEEREKTYKLAENIDAQLKRMAQDLKDIIEHLNTSGAPADTSDPLQQICKILNA
  HMDSLQWIDQNSALLQRKVEEVTKVCEGRRKEQERSFRITFD

• Sequence length: 522

Pathways

KEGG:

Nucleocytoplasmic transport
Amyotrophic lateral sclerosis

Reactome:

ISG15 antiviral mechanism
Transport of the SLBP independent Mature mRNA
Transport of the SLBP Dependant Mature mRNA
Transport of Mature mRNA Derived from an Intronless Transcript
Transport of Mature mRNA derived from an Intron-Containing Transcript
Rev-mediated nuclear export of HIV RNA
Transport of Ribonucleoproteins into the Host Nucleus
NS1 Mediated Effects on Host Pathways
Viral Messenger RNA Synthesis
NEP/NS2 Interacts with the Cellular Export Machinery
Regulation of Glucokinase by Glucokinase Regulatory Protein
Vpr-mediated nuclear import of PICs
snRNP Assembly
SUMOylation of DNA damage response and repair proteins
SUMOylation of ubiquitinylation proteins
Nuclear Pore Complex (NPC) Disassembly
Regulation of HSF1-mediated heat shock response
SUMOylation of SUMOylation proteins
SUMOylation of chromatin organization proteins
SUMOylation of RNA binding proteins
SUMOylation of DNA replication proteins
Transcriptional regulation by small RNAs
Defective TPR may confer susceptibility towards thyroid papillary carcinoma (TPC)
tRNA processing in the nucleus
HCMV Early Events
HCMV Late Events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Infantile bilateral striatal necrosis	Pathogenic	rs121917865	RCV000005018	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BILIARY CIRRHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial infantile bilateral striatal necrosis	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEARING LOSS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEIGH SYNDROME	—	ClinGen	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NUP62-related disorder	Benign; Uncertain significance; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CHOLANGITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute pancreatitis	Pancreatitis	BEFREE	29974378, 31122822		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	30114705		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	22963397, 29897944, 31665193, 31810936		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	16405664		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	31090940		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	19557423		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	28055007, 29576851		★☆☆☆☆ Found in Text Mining only
Aicardi Syndrome	Aicardi syndrome	Pubtator	37118353	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	33730050, 34818016	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	27737765, 28223223, 30235892, 31243684		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	22084127, 22972638, 23303844, 23417734, 23812289, 23884045, 24486447, 25114083, 25700176, 26302676, 26373655, 27016404, 27573878, 28076378, 28490746, 29432563, 29515358, 30867060, 30954537		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	27016404, 29889265, 37723585, 37957721	Associate	★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 2, JUVENILE (disorder)	Amyotrophic lateral sclerosis	BEFREE	20339559		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29153842		★☆☆☆☆ Found in Text Mining only
Antisynthetase syndrome	Antithrombin deficiency	Pubtator	32896253	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	29770139		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	26732762, 29285070, 30588824, 31101336		★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	35371338	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	30518408	Inhibit	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	16874300		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	26732762, 29285070, 30588824, 31101336		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	39741278	Associate	★☆☆☆☆ Found in Text Mining only
ATRICHIA WITH PAPULAR LESIONS	Atrichia With Papular Lesions	BEFREE	30114705		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	23421499, 25721883	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29328391, 29556265, 31849486		★☆☆☆☆ Found in Text Mining only
Basal ganglia cysts	Basal ganglia cysts	HPO_DG			★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	33957967	Stimulate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29383752		★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	37108591	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29048631		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	17187080	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	34389795	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12700667, 23134379, 27345399, 27758045, 28968743, 29898994, 30324661		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25721883, 26416451, 27384485, 27806347, 29729523, 31488317, 33632157	Associate	★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	23637164		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	34488443	Associate	★☆☆☆☆ Found in Text Mining only
C9 Deficiency	C9 deficiency	Pubtator	35697676	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	31316111	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31452949, 33123313, 36822623	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15926199, 23192274		★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	25031766	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10190901, 11549587, 15793865, 21730188, 24369267, 27391348, 28941211, 33362215, 34120890, 35472308, 35572840, 36822623, 37068178, 37081115	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27728799	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28402954	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	25031766	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	28257096	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29048631		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	31050705		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30793399, 31698589		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	27249597, 36325670	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35468095	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35571705, 37898101	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	29217659	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28498503, 29699801, 29844838		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	30094720		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	9462237		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	11549587, 2574140		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	11549587, 35725745, 37056930	Associate	★☆☆☆☆ Found in Text Mining only
Choreoathetosis	Choreoathetosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28006950, 28963374		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	11549587, 31183339		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne syndrome	Pubtator	9774388	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	19071211, 27573878		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23421499, 28903368, 30275562		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	31040926		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	1874294, 2200214, 24065390, 30793399, 8461612		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15793865, 23421499, 31057298, 32011477	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27031960, 30105541, 31260889		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	31501480		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30729704		★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	19557423		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	32896253	Associate	★☆☆☆☆ Found in Text Mining only
Developmental regression	Developmental regression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	26926601	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29294366, 30260594		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28935571, 30401435, 31466264		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	31649253	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	24492284, 29444469		★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	31452949	Associate	★☆☆☆☆ Found in Text Mining only
Digestive System Neoplasms	Digestive system neoplasm	Pubtator	15793865	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	31714914		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	31714914	Stimulate	★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	HPO_DG			★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26162509		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	33815277	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	29992166	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30306868, 30316442		★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Simplex Superficialis	Epidermolysis Bullosa	BEFREE	28450279		★☆☆☆☆ Found in Text Mining only
Epidermolysis bullosa with pyloric atresia	Epidermolysis bullosa	Pubtator	37118353	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	30840272	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	31755241, 33321911	Associate	★☆☆☆☆ Found in Text Mining only
Familial infantile bilateral striatal necrosis	Striatal Necrosis	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	BEFREE	28419832		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28968997, 29251796		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	30316442		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29414645, 30873635		★☆☆☆☆ Found in Text Mining only
Folic Acid Deficiency	Folic Acid Deficiency	BEFREE	30298448		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	28257096		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	19481605, 24042580, 26373655, 28490746, 30514811		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	26538301, 27334615, 35224690	Associate	★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	22366791, 22674379, 22972638, 24252525, 25185840, 27573878, 30954537		★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	15793865	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	26486234	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22525272, 31037147		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	25482944, 30678307, 31037147, 33105603, 35008590, 35229396	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22525272, 31037147		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22475378, 31444413, 31708690		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	29439667, 31037147	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	32124227	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	28941211	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	32124227	Associate	★☆☆☆☆ Found in Text Mining only
Horizontal pendular nystagmus	Horizontal pendular nystagmus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	21954231, 25311206		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	33730050, 35224690	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	30026731		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	29171783		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	25465707	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	31709727	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36805797	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	30460641		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	28968743		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	19071211, 27573878, 31107909		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myopathy, Sporadic	Inclusion body myopathy	BEFREE	19557423, 28159418, 31253480		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	28076378, 28794251, 30742062		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	28944847	Associate	★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	15926199		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	GENOMICS_ENGLAND_DG	16786527		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	31802633		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	31802633	Associate	★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	30094720		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29732938, 30675758		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	37898101	Associate	★☆☆☆☆ Found in Text Mining only
Lafora Disease	Lafora Disease	BEFREE	25412696		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	30498063		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	35898936	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30498063		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	29278715		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	29439841		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10190901, 11549587, 12118381, 21145819, 21482715, 24369267, 25026290, 2548435, 27211490, 27246794, 27404485, 28941211, 29311600, 29961754, 30793399, 31032410		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	11549587, 31183339		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	11549587, 37486962	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	28333129	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	27728799	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	31634464		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	23818065, 35224690, 35697676	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25897662, 33486901, 34080652	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26617774, 28257096	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	25362242	Inhibit	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12700667, 23134379, 27345399, 27758045, 28968743, 29898994, 30324661		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26162509		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31810986		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	31050705		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	11549587, 30793399		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30793399, 31698589		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	29439841		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29699801, 29844838		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15538718, 16405664, 25103771, 26552607, 29368435, 29383752, 29634950		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	28125038, 28724634, 30231994		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29328444, 30043279, 30158521		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	26707573		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29048631		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10190901, 11549587, 12118381, 16405664, 18931699, 20974803, 22424619, 24888590, 24927592, 28512249, 28968743, 29088798, 29153842, 29439841, 29634950, 29699801, 29702207, 29738493, 29898994, 30793399, 31040926, 31608105		★☆☆☆☆ Found in Text Mining only
Malignant Testicular Germ Cell Tumor	Malignant testicular germ cell tumor	BEFREE	26707573		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23421499, 28903368		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	29786968, 31363726		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	27345399		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	28257096		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	28257096		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	30339727		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28715145, 30581152		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28966079		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	28715145		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	29383752		★☆☆☆☆ Found in Text Mining only
Mild Mental Retardation	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	24714637	Inhibit	★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	18346206		★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	22084127, 27016404		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	23637164, 24252525, 25185840		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor neuron disease	Pubtator	24252525, 26538301	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	24971696		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	24971696	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Oculopharyngeal	Oculopharyngeal muscular dystrophy	Pubtator	36476314	Associate	★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	24618559		★☆☆☆☆ Found in Text Mining only
Myofibrillar Myopathy	Myofibrillar myopathy	BEFREE	17784878, 17931355		★☆☆☆☆ Found in Text Mining only
Myofibrillar Myopathy	Myofibrillar myopathy	Pubtator	17784878	Associate	★☆☆☆☆ Found in Text Mining only
Myopathies Nemaline	Nemaline myopathy	Pubtator	34043258	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	32896253	Associate	★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	24776709, 29780824, 32896253	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15926199, 1874294, 2188234, 2200214, 22424619, 23192274, 24065390, 24121124, 24475161, 24888590, 24927592, 25002027, 26268733, 26719575, 2679850, 28082672, 28292022, 28512249, 28988820, 29088798, 29551772, 29699801, 29702207, 29897944, 30072811, 30275562, 30410612, 30713500, 30793399, 30941888, 31040926, 31659256, 31715238, 31754084, 31802896		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22917563, 26509433, 28490746, 29535191		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	29889265	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	19071211, 19481605, 19557423, 26302676, 27573878, 28076378, 28975445, 30143980, 31818366		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	15926199		★☆☆☆☆ Found in Text Mining only
Neuronal intranuclear inclusion disease	Neuronal Intranuclear Inclusion Disease	BEFREE	31292692		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22963397, 23769318, 29793508, 30145802, 30237564		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	27404485, 29276215		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16517408, 28619261, 28966079, 29251796, 30588824		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29866118	Associate	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	28978813		★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	12857745, 15765181, 16813535, 17052185, 18083707, 18481983, 18765443, 19589897, 19858527, 23417734, 24486447, 29555685		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	35776529	Associate	★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	32519067	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	36567858	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30740681		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28915571		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24639013, 29617702, 29928361		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	31941496	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29699801, 29844838		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22074739, 24872956, 27249597, 27683123, 33924293, 36325670	Associate	★☆☆☆☆ Found in Text Mining only
Paget Disease	Paget disease	BEFREE	19589897, 23417734, 29555685		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	22264792		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30046371	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	15926199, 19557423, 28840510, 30055128, 30364275, 31501480, 31818366		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	23884045, 30055128, 33730050, 35454081	Associate	★☆☆☆☆ Found in Text Mining only
Pendular Nystagmus	Pendular nystagmus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	31161648		★☆☆☆☆ Found in Text Mining only
Periventricular Nodular Heterotopia	Periventricular nodular heterotopia	Pubtator	33517535	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	34638836	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	31256441		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	19557423, 28794251, 31253480		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	32896253	Associate	★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	28333129, 30623621		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15538718, 16405664, 25103771, 26552607, 29368435, 29383752, 29634950		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36517760	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	32910701	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	28006950		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30977401		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31810986		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27031960, 30105541, 31260889		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	29328447		★☆☆☆☆ Found in Text Mining only
RETINOSCHISIS 1, X-LINKED, JUVENILE	Retinoschisis, X-Linked	BEFREE	31342626		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30518408, 30538709, 31205465		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	26707573		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	27618275, 30877875		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	28724634		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	36581625	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	36805797	Associate	★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia Hereditary	Hereditary spastic paraplegia	Pubtator	34979968	Associate	★☆☆☆☆ Found in Text Mining only
Spastic tetraparesis	Spastic tetraparesis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	29672276		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 1	Spinocerebellar Ataxia	BEFREE	25888134		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 6 (disorder)	Spinocerebellar Ataxia	BEFREE	19788049		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	27706233, 28724634, 29217659, 29439841, 30134604, 9462237		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29551772		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28717222, 32814771	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	25714028		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	15926199, 25826083, 28419832, 29515134		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29328444, 30043279, 30158521		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30158521	Associate	★☆☆☆☆ Found in Text Mining only
STRIATONIGRAL DEGENERATION, INFANTILE (disorder)	Striatonigral Degeneration	GENOMICS_ENGLAND_DG	12374138, 14718703, 16786527, 27604308		★☆☆☆☆ Found in Text Mining only
STRIATONIGRAL DEGENERATION, INFANTILE (disorder)	Striatonigral Degeneration	BEFREE	16786527		★☆☆☆☆ Found in Text Mining only
STRIATONIGRAL DEGENERATION, INFANTILE (disorder)	Striatonigral Degeneration	UNIPROT_DG	16786527		★☆☆☆☆ Found in Text Mining only
STRIATONIGRAL DEGENERATION, INFANTILE (disorder)	Striatonigral Degeneration	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
STRIATONIGRAL DEGENERATION, INFANTILE (disorder)	Striatonigral Degeneration	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
STRIATONIGRAL DEGENERATION, INFANTILE (disorder)	Striatonigral Degeneration	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	22138392		★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	24618559		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	28257096	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	28966079		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	28257096	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	33910861	Associate	★☆☆☆☆ Found in Text Mining only
TIBIAL MUSCULAR DYSTROPHY, TARDIVE	Tibial muscular dystrophy	BEFREE	24618559		★☆☆☆☆ Found in Text Mining only
Torsades de Pointes	Torsades de pointes	Pubtator	25756586	Associate	★☆☆☆☆ Found in Text Mining only
Trichothiodystrophy Syndromes	Trichothiodystrophy	Pubtator	26340423	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22638807, 23328664		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	22638807, 28046018	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29422639		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28968601, 32273683, 34796446, 37083075, 38001512	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neurogenic	Neurogenic bladder	Pubtator	32896253	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	30316442		★☆☆☆☆ Found in Text Mining only
Vasculitis Leukocytoclastic Cutaneous	Vasculitis	Pubtator	36581625	Associate	★☆☆☆☆ Found in Text Mining only
Visceral myopathy familial external ophthalmoplegia	Visceral neuropathy	Pubtator	34070501	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	28186139	Associate	★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma pigmentosum	Pubtator	26340423	Associate	★☆☆☆☆ Found in Text Mining only