Gene Gene information from NCBI Gene database.
Entrez ID 23630
Gene name Potassium voltage-gated channel subfamily E regulatory subunit 5
Gene symbol KCNE5
Synonyms (NCBI Gene)
KCNE1L
Chromosome X
Chromosome location Xq23
Summary This gene encodes a member of a family of single pass transmembrane domain proteins that function as ancillary subunits to voltage-gated potassium channels. Members of this family affect diverse processes in potassium channel regulation, including ion sel
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
GO ID Ontology Definition Evidence Reference
GO:0005249 Function Voltage-gated potassium channel activity IEA
GO:0005251 Function Delayed rectifier potassium channel activity IBA
GO:0005515 Function Protein binding IPI 20533308, 32296183
GO:0005886 Component Plasma membrane IDA 20533308
GO:0006811 Process Monoatomic ion transport IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300328 6241 ENSG00000176076
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UJ90
Protein name Potassium voltage-gated channel subfamily E regulatory beta subunit 5 (AMME syndrome candidate gene 2 protein) (Potassium channel subunit beta MiRP4) (Potassium voltage-gated channel subfamily E member 1-like protein)
Protein function Potassium channel ancillary subunit that is essential for generation of some native K(+) currents by virtue of formation of heteromeric ion channel complex with voltage-gated potassium (Kv) channel pore-forming alpha subunits. Functions as an in
Family and domains
Tissue specificity TISSUE SPECIFICITY: Highly expressed in heart, skeletal muscle, brain, spinal cord and placenta. {ECO:0000269|PubMed:10493825}.
Sequence
MNCSESQRLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGREVTSAKGDDAY
LYILLIMIFYACLAGGLILAYTRSRKLVEAKDEPSQACAEHEWAPGGALTADAEAAAGSQ
AEGRRQLASEGLPALAQGAERV
Sequence length 142
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Phase 3 - rapid repolarisation
Phase 2 - plateau phase
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Brugada syndrome Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity ClinVar
ClinGen, GenCC, Orphanet
ClinGen, GenCC, Orphanet
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
KCNE5-related disorder Benign; Likely benign; Uncertain significance; Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute Coronary Syndrome Coronary Syndrome BEFREE 21985337
★☆☆☆☆
Found in Text Mining only
Alport Syndrome, Mental Retardation, Midface Hypoplasia, and Elliptocytosis Amme complex ORPHANET_DG
★☆☆☆☆
Found in Text Mining only
Alport syndrome-intellectual disability-midface hypoplasia-elliptocytosis syndrome Alport Syndrome-Intellectual Disability-Midface Hypoplasia-Elliptocytosis Syndrome Orphanet
★☆☆☆☆
Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia Arrhythmogenic right ventricular cardiomyopathy Pubtator 30129429 Associate
★☆☆☆☆
Found in Text Mining only
Atrial Fibrillation Atrial Fibrillation BEFREE 16054468, 18313602, 30289750
★☆☆☆☆
Found in Text Mining only
Atrial Fibrillation Atrial Fibrillation LHGDN 18313602
★☆☆☆☆
Found in Text Mining only
Atrial Fibrillation Atrial fibrillation Pubtator 18313602, 21924735, 21967835 Associate
★☆☆☆☆
Found in Text Mining only
Atrial Fibrillation Atrial Fibrillation GENOMICS_ENGLAND_DG 29350269, 30289750
★☆☆☆☆
Found in Text Mining only
Brugada syndrome Brugada Syndrome Orphanet
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
Brugada Syndrome Brugada syndrome Pubtator 21967835 Associate
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)