Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	23625
Gene name	Family with sequence similarity 89 member B
Gene symbol	FAM89B
Synonyms (NCBI Gene)	LRAP25MTVRMTVR1
Chromosome	11
Chromosome location	11q13.1

Show/Hide all (87)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025771	hsa-miR-7-5p	Microarray	19073608
MIRT038867	hsa-miR-93-3p	CLASH	23622248
MIRT988437	hsa-miR-1233	CLIP-seq
MIRT988438	hsa-miR-1280	CLIP-seq
MIRT988439	hsa-miR-1293	CLIP-seq
MIRT988440	hsa-miR-129-3p	CLIP-seq
MIRT988441	hsa-miR-1302	CLIP-seq
MIRT988442	hsa-miR-1912	CLIP-seq
MIRT988443	hsa-miR-2467-3p	CLIP-seq
MIRT988444	hsa-miR-296-3p	CLIP-seq
MIRT988445	hsa-miR-296-5p	CLIP-seq
MIRT988446	hsa-miR-3122	CLIP-seq
MIRT988447	hsa-miR-3125	CLIP-seq
MIRT988448	hsa-miR-3181	CLIP-seq
MIRT988449	hsa-miR-3187-3p	CLIP-seq
MIRT988450	hsa-miR-320e	CLIP-seq
MIRT988451	hsa-miR-342-5p	CLIP-seq
MIRT988452	hsa-miR-3659	CLIP-seq
MIRT988453	hsa-miR-3689d	CLIP-seq
MIRT988454	hsa-miR-3690	CLIP-seq
MIRT988455	hsa-miR-3913-5p	CLIP-seq
MIRT988456	hsa-miR-3914	CLIP-seq
MIRT988457	hsa-miR-3916	CLIP-seq
MIRT988458	hsa-miR-3926	CLIP-seq
MIRT988459	hsa-miR-3928	CLIP-seq
MIRT988460	hsa-miR-3929	CLIP-seq
MIRT988461	hsa-miR-3939	CLIP-seq
MIRT988462	hsa-miR-3940-3p	CLIP-seq
MIRT988463	hsa-miR-3944-3p	CLIP-seq
MIRT988464	hsa-miR-4254	CLIP-seq
MIRT988465	hsa-miR-4298	CLIP-seq
MIRT988466	hsa-miR-4419b	CLIP-seq
MIRT988467	hsa-miR-4435	CLIP-seq
MIRT988468	hsa-miR-4436b-3p	CLIP-seq
MIRT988469	hsa-miR-4478	CLIP-seq
MIRT988470	hsa-miR-4483	CLIP-seq
MIRT988471	hsa-miR-4491	CLIP-seq
MIRT988472	hsa-miR-4643	CLIP-seq
MIRT988473	hsa-miR-4657	CLIP-seq
MIRT988474	hsa-miR-4658	CLIP-seq
MIRT988475	hsa-miR-4664-5p	CLIP-seq
MIRT988476	hsa-miR-4685-5p	CLIP-seq
MIRT988477	hsa-miR-4701-5p	CLIP-seq
MIRT988478	hsa-miR-4708-3p	CLIP-seq
MIRT988479	hsa-miR-4731-5p	CLIP-seq
MIRT988480	hsa-miR-4750	CLIP-seq
MIRT988481	hsa-miR-4758-3p	CLIP-seq
MIRT988482	hsa-miR-548s	CLIP-seq
MIRT988483	hsa-miR-574-5p	CLIP-seq
MIRT988484	hsa-miR-588	CLIP-seq
MIRT988485	hsa-miR-637	CLIP-seq
MIRT988486	hsa-miR-876-3p	CLIP-seq
MIRT988438	hsa-miR-1280	CLIP-seq
MIRT1992937	hsa-miR-1294	CLIP-seq
MIRT1992938	hsa-miR-1914	CLIP-seq
MIRT988445	hsa-miR-296-5p	CLIP-seq
MIRT988448	hsa-miR-3181	CLIP-seq
MIRT1992939	hsa-miR-3197	CLIP-seq
MIRT988463	hsa-miR-3944-3p	CLIP-seq
MIRT1992940	hsa-miR-4278	CLIP-seq
MIRT1992941	hsa-miR-4316	CLIP-seq
MIRT1992942	hsa-miR-4677-3p	CLIP-seq
MIRT1992943	hsa-miR-4710	CLIP-seq
MIRT1992944	hsa-miR-4716-3p	CLIP-seq
MIRT988480	hsa-miR-4750	CLIP-seq
MIRT988481	hsa-miR-4758-3p	CLIP-seq
MIRT2226876	hsa-miR-1271	CLIP-seq
MIRT2226877	hsa-miR-1281	CLIP-seq
MIRT2226878	hsa-miR-1291	CLIP-seq
MIRT988439	hsa-miR-1293	CLIP-seq
MIRT2226879	hsa-miR-182	CLIP-seq
MIRT2226880	hsa-miR-328	CLIP-seq
MIRT2226881	hsa-miR-34a	CLIP-seq
MIRT2226882	hsa-miR-34c-5p	CLIP-seq
MIRT2226883	hsa-miR-3915	CLIP-seq
MIRT2226884	hsa-miR-3921	CLIP-seq
MIRT988459	hsa-miR-3928	CLIP-seq
MIRT2226885	hsa-miR-4290	CLIP-seq
MIRT988470	hsa-miR-4483	CLIP-seq
MIRT2226886	hsa-miR-449a	CLIP-seq
MIRT2226887	hsa-miR-449b	CLIP-seq
MIRT2226888	hsa-miR-4530	CLIP-seq
MIRT2226889	hsa-miR-4649-3p	CLIP-seq
MIRT2226890	hsa-miR-4653-5p	CLIP-seq
MIRT2226891	hsa-miR-4667-3p	CLIP-seq
MIRT988486	hsa-miR-876-3p	CLIP-seq
MIRT2226892	hsa-miR-96	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence
GO:0001222	Function	Transcription corepressor binding	IBA
GO:0001222	Function	Transcription corepressor binding	IEA
GO:0001222	Function	Transcription corepressor binding	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0030010	Process	Establishment of cell polarity	IBA
GO:0030010	Process	Establishment of cell polarity	IEA
GO:0030010	Process	Establishment of cell polarity	ISS
GO:0030027	Component	Lamellipodium	IBA
GO:0030027	Component	Lamellipodium	IEA
GO:0030027	Component	Lamellipodium	ISS
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030335	Process	Positive regulation of cell migration	ISS
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IBA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	ISS
GO:0042995	Component	Cell projection	IEA
GO:0060392	Process	Negative regulation of SMAD protein signal transduction	IBA
GO:0060392	Process	Negative regulation of SMAD protein signal transduction	IEA
GO:0060392	Process	Negative regulation of SMAD protein signal transduction	ISS

MIM	HGNC	e!Ensembl
616128	16708	ENSG00000176973

Q8N5H3

Protein name

Leucine repeat adapter protein 25

Protein function

Negatively regulates TGF-beta-induced signaling; in cooperation with SKI prevents the translocation of SMAD2 from the nucleus to the cytoplasm in response to TGF-beta. Acts as an adapter that mediates the specific recognition of LIMK1 by CDC42BP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14854	LURAP	75 → 152	Leucine rich adaptor protein	Family

Sequence

MNGLPSAEAPGGAGCALAGLPPLPRGLSGLLNASGGSWRELERVYSQRSRIHDELSRAAR
APDGPRHAAGAANAGPAAGPRRPVNLDSALAALRKEMVGLRQLDMSLLCQLWGLYESIQD
YKHLCQDLSFCQDLSSSLHSDSSYPPDAGLSDDEEPPDASLPPDPPPLTVPQTHNARDQW
LQDAFHISL

Sequence length

189

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

FAM89B (family with sequence similarity 89 member B)