BACE1 (beta-secretase 1)

Gene

• Entrez ID: 23621
• Gene name: Beta-secretase 1
• Gene symbol: BACE1
• Synonyms (NCBI Gene): ASP2, BACE, HSPC104
• Chromosome: 11
• Chromosome location: 11q23.3
• Summary: This gene encodes a member of the peptidase A1 family of aspartic proteases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protease. Thi

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000800	hsa-miR-107	Western blot, Northern blot	18234899
MIRT001825	hsa-miR-124-3p	Luciferase reporter assay	18434550
MIRT001802	hsa-miR-15a-5p	Luciferase reporter assay	18434550
MIRT001793	hsa-miR-19b-3p	Luciferase reporter assay	18434550
MIRT001766	hsa-miR-29a-3p	Luciferase reporter assay, Western blot	18434550
MIRT000930	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	18434550
MIRT001736	hsa-miR-9-5p	Luciferase reporter assay	18434550
MIRT000930	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	18434550
MIRT000800	hsa-miR-107	Western blot, Northern blot	18234899
MIRT000800	hsa-miR-107	Western blot, Northern blot	18234899
MIRT000800	hsa-miR-107	Western blot, Northern blot	18234899
MIRT000800	hsa-miR-107	Luciferase reporter assay	18234899
MIRT000103	hsa-miR-298	Luciferase reporter assay	18642050
MIRT001766	hsa-miR-29a-3p	Luciferase reporter assay	18434550
MIRT000930	hsa-miR-29b-3p	Luciferase reporter assay	18434550
MIRT000080	hsa-miR-328-3p	Luciferase reporter assay	18716028
MIRT020416	hsa-miR-29c-3p	Reporter assay;Western blot;qRT-PCR	21565331
MIRT001736	hsa-miR-9-5p	Reporter assay;Other	18434550
MIRT000800	hsa-miR-107	Western blot;Microarray	20489155
MIRT000800	hsa-miR-107	Reporter assay	18234899
MIRT001766	hsa-miR-29a-3p	Reporter assay;Other	18434550
MIRT030156	hsa-miR-26b-5p	Microarray	19088304
MIRT001793	hsa-miR-19b-3p	Reporter assay;Other	18434550
MIRT001802	hsa-miR-15a-5p	Reporter assay;Other	18434550
MIRT050944	hsa-miR-17-5p	CLASH	23622248
MIRT438049	hsa-miR-339-5p	Luciferase reporter assay, qRT-PCR, Western blot	24352696
MIRT438049	hsa-miR-339-5p	Luciferase reporter assay, qRT-PCR, Western blot	24352696
MIRT438049	hsa-miR-339-5p	Luciferase reporter assay, qRT-PCR, Western blot	24352696
MIRT438049	hsa-miR-339-5p	Luciferase reporter assay, qRT-PCR, Western blot	24352696
MIRT438049	hsa-miR-339-5p	Luciferase reporter assay, qRT-PCR, Western blot	24352696
MIRT438049	hsa-miR-339-5p	Luciferase reporter assay, qRT-PCR, Western blot	24352696
MIRT438049	hsa-miR-339-5p	Luciferase reporter assay, qRT-PCR, Western blot	24352696
MIRT438049	hsa-miR-339-5p	Luciferase reporter assay, qRT-PCR, Western blot	24352696
MIRT714365	hsa-miR-1267	HITS-CLIP	19536157
MIRT714364	hsa-miR-7159-5p	HITS-CLIP	19536157
MIRT714363	hsa-miR-505-3p	HITS-CLIP	19536157
MIRT714362	hsa-miR-421	HITS-CLIP	19536157
MIRT714361	hsa-miR-653-5p	HITS-CLIP	19536157
MIRT714365	hsa-miR-1267	HITS-CLIP	19536157
MIRT714364	hsa-miR-7159-5p	HITS-CLIP	19536157
MIRT714363	hsa-miR-505-3p	HITS-CLIP	19536157
MIRT714362	hsa-miR-421	HITS-CLIP	19536157
MIRT714361	hsa-miR-653-5p	HITS-CLIP	19536157
MIRT732050	hsa-miR-16-5p	ELISA, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	26440600
MIRT732050	hsa-miR-16-5p	ELISA, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	26440600
MIRT732050	hsa-miR-16-5p	ELISA, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	26440600
MIRT732050	hsa-miR-16-5p	ELISA, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	26440600
MIRT000930	hsa-miR-29b-3p	ELISA	26818210
MIRT020416	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR, Western blot	25973041
MIRT732984	hsa-miR-31-5p	Immunohistochemistry (IHC), qRT-PCR	32069773
MIRT000800	hsa-miR-107	Luciferase reporter assay, Western blotting, qRT-PCR	32674073
MIRT714365	hsa-miR-1267	HITS-CLIP	19536157
MIRT714364	hsa-miR-7159-5p	HITS-CLIP	19536157
MIRT714363	hsa-miR-505-3p	HITS-CLIP	19536157
MIRT714362	hsa-miR-421	HITS-CLIP	19536157
MIRT714361	hsa-miR-653-5p	HITS-CLIP	19536157
MIRT714365	hsa-miR-1267	HITS-CLIP	19536157
MIRT714364	hsa-miR-7159-5p	HITS-CLIP	19536157
MIRT714363	hsa-miR-505-3p	HITS-CLIP	19536157
MIRT714362	hsa-miR-421	HITS-CLIP	19536157
MIRT714361	hsa-miR-653-5p	HITS-CLIP	19536157
MIRT814134	hsa-miR-1252	CLIP-seq
MIRT814135	hsa-miR-1912	CLIP-seq
MIRT814136	hsa-miR-28-5p	CLIP-seq
MIRT814137	hsa-miR-3139	CLIP-seq
MIRT814138	hsa-miR-3153	CLIP-seq
MIRT814139	hsa-miR-345	CLIP-seq
MIRT814140	hsa-miR-374a	CLIP-seq
MIRT814141	hsa-miR-374b	CLIP-seq
MIRT814142	hsa-miR-3925-5p	CLIP-seq
MIRT814143	hsa-miR-4260	CLIP-seq
MIRT814144	hsa-miR-4266	CLIP-seq
MIRT814145	hsa-miR-4271	CLIP-seq
MIRT814146	hsa-miR-4476	CLIP-seq
MIRT814147	hsa-miR-4533	CLIP-seq
MIRT814148	hsa-miR-4685-5p	CLIP-seq
MIRT814149	hsa-miR-4704-3p	CLIP-seq
MIRT814150	hsa-miR-4706	CLIP-seq
MIRT814151	hsa-miR-4709-3p	CLIP-seq
MIRT814152	hsa-miR-4725-3p	CLIP-seq
MIRT814153	hsa-miR-4728-5p	CLIP-seq
MIRT814154	hsa-miR-4731-3p	CLIP-seq
MIRT814155	hsa-miR-4749-5p	CLIP-seq
MIRT814156	hsa-miR-4773	CLIP-seq
MIRT814157	hsa-miR-4775	CLIP-seq
MIRT814158	hsa-miR-4781-5p	CLIP-seq
MIRT814159	hsa-miR-4801	CLIP-seq
MIRT814160	hsa-miR-486-3p	CLIP-seq
MIRT814161	hsa-miR-508-5p	CLIP-seq
MIRT814162	hsa-miR-548a-3p	CLIP-seq
MIRT814163	hsa-miR-548ae	CLIP-seq
MIRT814164	hsa-miR-548aj	CLIP-seq
MIRT814165	hsa-miR-548am	CLIP-seq
MIRT814166	hsa-miR-548e	CLIP-seq
MIRT814167	hsa-miR-548f	CLIP-seq
MIRT814168	hsa-miR-548x	CLIP-seq
MIRT814169	hsa-miR-577	CLIP-seq
MIRT814170	hsa-miR-589	CLIP-seq
MIRT814171	hsa-miR-590-3p	CLIP-seq
MIRT814172	hsa-miR-708	CLIP-seq
MIRT814173	hsa-miR-1207-3p	CLIP-seq
MIRT814174	hsa-miR-1244	CLIP-seq
MIRT814134	hsa-miR-1252	CLIP-seq
MIRT814175	hsa-miR-1295	CLIP-seq
MIRT814176	hsa-miR-15a	CLIP-seq
MIRT814177	hsa-miR-15b	CLIP-seq
MIRT814178	hsa-miR-16	CLIP-seq
MIRT814179	hsa-miR-195	CLIP-seq
MIRT814180	hsa-miR-29a	CLIP-seq
MIRT814181	hsa-miR-29b	CLIP-seq
MIRT814182	hsa-miR-29c	CLIP-seq
MIRT814183	hsa-miR-3064-5p	CLIP-seq
MIRT814184	hsa-miR-3065-3p	CLIP-seq
MIRT814185	hsa-miR-3120-3p	CLIP-seq
MIRT814186	hsa-miR-3127-5p	CLIP-seq
MIRT814187	hsa-miR-3145-3p	CLIP-seq
MIRT814188	hsa-miR-3157-5p	CLIP-seq
MIRT814189	hsa-miR-330-3p	CLIP-seq
MIRT814190	hsa-miR-3591-3p	CLIP-seq
MIRT814191	hsa-miR-3607-3p	CLIP-seq
MIRT814192	hsa-miR-3653	CLIP-seq
MIRT814193	hsa-miR-3658	CLIP-seq
MIRT814194	hsa-miR-3689a-5p	CLIP-seq
MIRT814195	hsa-miR-3689b	CLIP-seq
MIRT814196	hsa-miR-3689e	CLIP-seq
MIRT814197	hsa-miR-3689f	CLIP-seq
MIRT814198	hsa-miR-3918	CLIP-seq
MIRT814199	hsa-miR-424	CLIP-seq
MIRT814200	hsa-miR-4287	CLIP-seq
MIRT814201	hsa-miR-4290	CLIP-seq
MIRT814202	hsa-miR-4446-3p	CLIP-seq
MIRT814203	hsa-miR-4446-5p	CLIP-seq
MIRT814204	hsa-miR-4469	CLIP-seq
MIRT814146	hsa-miR-4476	CLIP-seq
MIRT814205	hsa-miR-4477a	CLIP-seq
MIRT814147	hsa-miR-4533	CLIP-seq
MIRT814206	hsa-miR-4649-3p	CLIP-seq
MIRT814207	hsa-miR-4656	CLIP-seq
MIRT814208	hsa-miR-4667-3p	CLIP-seq
MIRT814209	hsa-miR-4670-3p	CLIP-seq
MIRT814210	hsa-miR-4685-3p	CLIP-seq
MIRT814211	hsa-miR-4691-3p	CLIP-seq
MIRT814212	hsa-miR-4717-5p	CLIP-seq
MIRT814213	hsa-miR-4755-5p	CLIP-seq
MIRT814214	hsa-miR-497	CLIP-seq
MIRT814215	hsa-miR-498	CLIP-seq
MIRT814216	hsa-miR-519a	CLIP-seq
MIRT814217	hsa-miR-519b-3p	CLIP-seq
MIRT814218	hsa-miR-519c-3p	CLIP-seq
MIRT814219	hsa-miR-642a	CLIP-seq
MIRT814220	hsa-miR-643	CLIP-seq
MIRT814221	hsa-miR-653	CLIP-seq
MIRT814222	hsa-miR-873	CLIP-seq
MIRT814223	hsa-miR-922	CLIP-seq
MIRT1545671	hsa-miR-1200	CLIP-seq
MIRT1545672	hsa-miR-3150a-3p	CLIP-seq
MIRT1545673	hsa-miR-3175	CLIP-seq
MIRT1545674	hsa-miR-3176	CLIP-seq
MIRT1545675	hsa-miR-3194-3p	CLIP-seq
MIRT1545676	hsa-miR-3907	CLIP-seq
MIRT1545677	hsa-miR-3922-3p	CLIP-seq
MIRT1545678	hsa-miR-4324	CLIP-seq
MIRT1545679	hsa-miR-4701-5p	CLIP-seq
MIRT1545680	hsa-miR-4711-3p	CLIP-seq
MIRT814153	hsa-miR-4728-5p	CLIP-seq
MIRT1545681	hsa-miR-491-5p	CLIP-seq
MIRT1545682	hsa-miR-544b	CLIP-seq
MIRT1545683	hsa-miR-552	CLIP-seq
MIRT1545684	hsa-miR-588	CLIP-seq
MIRT1545685	hsa-miR-764	CLIP-seq
MIRT1545686	hsa-miR-939	CLIP-seq
MIRT1940726	hsa-miR-2682	CLIP-seq
MIRT1940727	hsa-miR-3714	CLIP-seq
MIRT1940728	hsa-miR-449c	CLIP-seq
MIRT1940729	hsa-miR-3132	CLIP-seq
MIRT1940730	hsa-miR-3156-3p	CLIP-seq
MIRT1545675	hsa-miR-3194-3p	CLIP-seq
MIRT1940731	hsa-miR-4301	CLIP-seq
MIRT814203	hsa-miR-4446-5p	CLIP-seq
MIRT1940732	hsa-miR-4727-5p	CLIP-seq
MIRT1545671	hsa-miR-1200	CLIP-seq
MIRT2179726	hsa-miR-128	CLIP-seq
MIRT2179727	hsa-miR-1293	CLIP-seq
MIRT2179728	hsa-miR-140-3p	CLIP-seq
MIRT2179729	hsa-miR-2114	CLIP-seq
MIRT2179730	hsa-miR-27a	CLIP-seq
MIRT2179731	hsa-miR-27b	CLIP-seq
MIRT1545672	hsa-miR-3150a-3p	CLIP-seq
MIRT814138	hsa-miR-3153	CLIP-seq
MIRT1545673	hsa-miR-3175	CLIP-seq
MIRT1545674	hsa-miR-3176	CLIP-seq
MIRT2179732	hsa-miR-3189-3p	CLIP-seq
MIRT1545675	hsa-miR-3194-3p	CLIP-seq
MIRT2179733	hsa-miR-3649	CLIP-seq
MIRT1545676	hsa-miR-3907	CLIP-seq
MIRT1545677	hsa-miR-3922-3p	CLIP-seq
MIRT2179734	hsa-miR-4274	CLIP-seq
MIRT2179735	hsa-miR-4308	CLIP-seq
MIRT1545678	hsa-miR-4324	CLIP-seq
MIRT2179736	hsa-miR-4483	CLIP-seq
MIRT2179737	hsa-miR-4519	CLIP-seq
MIRT2179738	hsa-miR-4642	CLIP-seq
MIRT814148	hsa-miR-4685-5p	CLIP-seq
MIRT1545679	hsa-miR-4701-5p	CLIP-seq
MIRT814153	hsa-miR-4728-5p	CLIP-seq
MIRT2179739	hsa-miR-4778-5p	CLIP-seq
MIRT2179740	hsa-miR-4795-3p	CLIP-seq
MIRT2179741	hsa-miR-4803	CLIP-seq
MIRT1545681	hsa-miR-491-5p	CLIP-seq
MIRT2179742	hsa-miR-499-3p	CLIP-seq
MIRT2179743	hsa-miR-499a-3p	CLIP-seq
MIRT814161	hsa-miR-508-5p	CLIP-seq
MIRT2179744	hsa-miR-5096	CLIP-seq
MIRT2179745	hsa-miR-513a-5p	CLIP-seq
MIRT1545682	hsa-miR-544b	CLIP-seq
MIRT1545683	hsa-miR-552	CLIP-seq
MIRT1545684	hsa-miR-588	CLIP-seq
MIRT2179746	hsa-miR-671-5p	CLIP-seq
MIRT1545685	hsa-miR-764	CLIP-seq
MIRT1545686	hsa-miR-939	CLIP-seq
MIRT2444589	hsa-miR-1246	CLIP-seq
MIRT2444590	hsa-miR-1263	CLIP-seq
MIRT2444591	hsa-miR-127-5p	CLIP-seq
MIRT2179726	hsa-miR-128	CLIP-seq
MIRT2444592	hsa-miR-1287	CLIP-seq
MIRT2444593	hsa-miR-1290	CLIP-seq
MIRT2444594	hsa-miR-1321	CLIP-seq
MIRT2444595	hsa-miR-141	CLIP-seq
MIRT2444596	hsa-miR-1972	CLIP-seq
MIRT2444597	hsa-miR-19a	CLIP-seq
MIRT2444598	hsa-miR-19b	CLIP-seq
MIRT2444599	hsa-miR-200a	CLIP-seq
MIRT2179730	hsa-miR-27a	CLIP-seq
MIRT2179731	hsa-miR-27b	CLIP-seq
MIRT2444600	hsa-miR-3134	CLIP-seq
MIRT2444601	hsa-miR-3135b	CLIP-seq
MIRT2444602	hsa-miR-3146	CLIP-seq
MIRT2444603	hsa-miR-3150b-3p	CLIP-seq
MIRT2444604	hsa-miR-3152-5p	CLIP-seq
MIRT814138	hsa-miR-3153	CLIP-seq
MIRT2444605	hsa-miR-3162-5p	CLIP-seq
MIRT2444606	hsa-miR-3167	CLIP-seq
MIRT2444607	hsa-miR-342-5p	CLIP-seq
MIRT2444608	hsa-miR-3611	CLIP-seq
MIRT2444609	hsa-miR-3614-5p	CLIP-seq
MIRT2444610	hsa-miR-3620	CLIP-seq
MIRT2444611	hsa-miR-3663-5p	CLIP-seq
MIRT2444612	hsa-miR-3674	CLIP-seq
MIRT2444613	hsa-miR-4289	CLIP-seq
MIRT2444614	hsa-miR-4320	CLIP-seq
MIRT2444615	hsa-miR-450b-3p	CLIP-seq
MIRT2444616	hsa-miR-451b	CLIP-seq
MIRT2444617	hsa-miR-4651	CLIP-seq
MIRT2444618	hsa-miR-4664-5p	CLIP-seq
MIRT2444619	hsa-miR-4689	CLIP-seq
MIRT2444620	hsa-miR-4710	CLIP-seq
MIRT2444621	hsa-miR-4726-3p	CLIP-seq
MIRT2444622	hsa-miR-4739	CLIP-seq
MIRT2444623	hsa-miR-4753-3p	CLIP-seq
MIRT2444624	hsa-miR-4756-5p	CLIP-seq
MIRT2444625	hsa-miR-4768-5p	CLIP-seq
MIRT814157	hsa-miR-4775	CLIP-seq
MIRT2444626	hsa-miR-4784	CLIP-seq
MIRT2179745	hsa-miR-513a-5p	CLIP-seq
MIRT814171	hsa-miR-590-3p	CLIP-seq
MIRT2444627	hsa-miR-608	CLIP-seq
MIRT2444628	hsa-miR-635	CLIP-seq
MIRT2444629	hsa-miR-654-3p	CLIP-seq
MIRT2444630	hsa-miR-769-3p	CLIP-seq
MIRT2444631	hsa-miR-876-5p	CLIP-seq
MIRT2483119	hsa-miR-1225-5p	CLIP-seq
MIRT2444589	hsa-miR-1246	CLIP-seq
MIRT2444590	hsa-miR-1263	CLIP-seq
MIRT2483120	hsa-miR-1270	CLIP-seq
MIRT2444591	hsa-miR-127-5p	CLIP-seq
MIRT2444592	hsa-miR-1287	CLIP-seq
MIRT2444593	hsa-miR-1290	CLIP-seq
MIRT2444594	hsa-miR-1321	CLIP-seq
MIRT2483121	hsa-miR-133a	CLIP-seq
MIRT2483122	hsa-miR-133b	CLIP-seq
MIRT2483123	hsa-miR-1343	CLIP-seq
MIRT2444595	hsa-miR-141	CLIP-seq
MIRT2444597	hsa-miR-19a	CLIP-seq
MIRT2444598	hsa-miR-19b	CLIP-seq
MIRT2444599	hsa-miR-200a	CLIP-seq
MIRT2483124	hsa-miR-223	CLIP-seq
MIRT1940726	hsa-miR-2682	CLIP-seq
MIRT814136	hsa-miR-28-5p	CLIP-seq
MIRT2483125	hsa-miR-299-5p	CLIP-seq
MIRT2444600	hsa-miR-3134	CLIP-seq
MIRT2444601	hsa-miR-3135b	CLIP-seq
MIRT2483126	hsa-miR-3138	CLIP-seq
MIRT814137	hsa-miR-3139	CLIP-seq
MIRT2444602	hsa-miR-3146	CLIP-seq
MIRT2444603	hsa-miR-3150b-3p	CLIP-seq
MIRT2444604	hsa-miR-3152-5p	CLIP-seq
MIRT2444605	hsa-miR-3162-5p	CLIP-seq
MIRT2483127	hsa-miR-3165	CLIP-seq
MIRT2444606	hsa-miR-3167	CLIP-seq
MIRT2483128	hsa-miR-3173-3p	CLIP-seq
MIRT2179732	hsa-miR-3189-3p	CLIP-seq
MIRT2444607	hsa-miR-342-5p	CLIP-seq
MIRT2444609	hsa-miR-3614-5p	CLIP-seq
MIRT2179733	hsa-miR-3649	CLIP-seq
MIRT2444612	hsa-miR-3674	CLIP-seq
MIRT2483129	hsa-miR-3689d	CLIP-seq
MIRT1940727	hsa-miR-3714	CLIP-seq
MIRT2483130	hsa-miR-378	CLIP-seq
MIRT2483131	hsa-miR-378b	CLIP-seq
MIRT2483132	hsa-miR-378c	CLIP-seq
MIRT2483133	hsa-miR-378d	CLIP-seq
MIRT2483134	hsa-miR-378e	CLIP-seq
MIRT2483135	hsa-miR-378f	CLIP-seq
MIRT2483136	hsa-miR-378h	CLIP-seq
MIRT2483137	hsa-miR-378i	CLIP-seq
MIRT2483138	hsa-miR-3940-5p	CLIP-seq
MIRT2483139	hsa-miR-409-3p	CLIP-seq
MIRT2483140	hsa-miR-422a	CLIP-seq
MIRT814144	hsa-miR-4266	CLIP-seq
MIRT2483141	hsa-miR-4278	CLIP-seq
MIRT2483142	hsa-miR-4281	CLIP-seq
MIRT2483143	hsa-miR-4286	CLIP-seq
MIRT1940731	hsa-miR-4301	CLIP-seq
MIRT2444614	hsa-miR-4320	CLIP-seq
MIRT2483144	hsa-miR-4328	CLIP-seq
MIRT2483145	hsa-miR-4422	CLIP-seq
MIRT2483146	hsa-miR-4428	CLIP-seq
MIRT2483147	hsa-miR-4434	CLIP-seq
MIRT2483148	hsa-miR-4477b	CLIP-seq
MIRT2483149	hsa-miR-4487	CLIP-seq
MIRT2483150	hsa-miR-4493	CLIP-seq
MIRT1940728	hsa-miR-449c	CLIP-seq
MIRT2483151	hsa-miR-4507	CLIP-seq
MIRT2444615	hsa-miR-450b-3p	CLIP-seq
MIRT2483152	hsa-miR-4516	CLIP-seq
MIRT2444616	hsa-miR-451b	CLIP-seq
MIRT2483153	hsa-miR-4531	CLIP-seq
MIRT2179738	hsa-miR-4642	CLIP-seq
MIRT2444617	hsa-miR-4651	CLIP-seq
MIRT2444618	hsa-miR-4664-5p	CLIP-seq
MIRT814148	hsa-miR-4685-5p	CLIP-seq
MIRT2444619	hsa-miR-4689	CLIP-seq
MIRT814150	hsa-miR-4706	CLIP-seq
MIRT2444620	hsa-miR-4710	CLIP-seq
MIRT2483154	hsa-miR-4716-3p	CLIP-seq
MIRT2483155	hsa-miR-4724-5p	CLIP-seq
MIRT2444621	hsa-miR-4726-3p	CLIP-seq
MIRT814153	hsa-miR-4728-5p	CLIP-seq
MIRT2483156	hsa-miR-4738-3p	CLIP-seq
MIRT2444622	hsa-miR-4739	CLIP-seq
MIRT814155	hsa-miR-4749-5p	CLIP-seq
MIRT2444623	hsa-miR-4753-3p	CLIP-seq
MIRT2444624	hsa-miR-4756-5p	CLIP-seq
MIRT2444625	hsa-miR-4768-5p	CLIP-seq
MIRT814157	hsa-miR-4775	CLIP-seq
MIRT814158	hsa-miR-4781-5p	CLIP-seq
MIRT2444626	hsa-miR-4784	CLIP-seq
MIRT2483157	hsa-miR-4790-3p	CLIP-seq
MIRT2483158	hsa-miR-548b-3p	CLIP-seq
MIRT814171	hsa-miR-590-3p	CLIP-seq
MIRT2444627	hsa-miR-608	CLIP-seq
MIRT2483159	hsa-miR-617	CLIP-seq
MIRT2483160	hsa-miR-620	CLIP-seq
MIRT2444628	hsa-miR-635	CLIP-seq
MIRT814220	hsa-miR-643	CLIP-seq
MIRT2444629	hsa-miR-654-3p	CLIP-seq
MIRT2483161	hsa-miR-661	CLIP-seq
MIRT2483162	hsa-miR-662	CLIP-seq
MIRT814172	hsa-miR-708	CLIP-seq
MIRT2444630	hsa-miR-769-3p	CLIP-seq
MIRT2444631	hsa-miR-876-5p	CLIP-seq
MIRT2444623	hsa-miR-4753-3p	CLIP-seq
MIRT814173	hsa-miR-1207-3p	CLIP-seq
MIRT2483119	hsa-miR-1225-5p	CLIP-seq
MIRT2444589	hsa-miR-1246	CLIP-seq
MIRT2444590	hsa-miR-1263	CLIP-seq
MIRT2483120	hsa-miR-1270	CLIP-seq
MIRT2444591	hsa-miR-127-5p	CLIP-seq
MIRT2179726	hsa-miR-128	CLIP-seq
MIRT2444592	hsa-miR-1287	CLIP-seq
MIRT2444593	hsa-miR-1290	CLIP-seq
MIRT2444594	hsa-miR-1321	CLIP-seq
MIRT2483121	hsa-miR-133a	CLIP-seq
MIRT2483122	hsa-miR-133b	CLIP-seq
MIRT2483123	hsa-miR-1343	CLIP-seq
MIRT2675833	hsa-miR-135a	CLIP-seq
MIRT2675834	hsa-miR-135b	CLIP-seq
MIRT2444595	hsa-miR-141	CLIP-seq
MIRT2444597	hsa-miR-19a	CLIP-seq
MIRT2444598	hsa-miR-19b	CLIP-seq
MIRT2444599	hsa-miR-200a	CLIP-seq
MIRT2483124	hsa-miR-223	CLIP-seq
MIRT1940726	hsa-miR-2682	CLIP-seq
MIRT2179730	hsa-miR-27a	CLIP-seq
MIRT2179731	hsa-miR-27b	CLIP-seq
MIRT814136	hsa-miR-28-5p	CLIP-seq
MIRT2483125	hsa-miR-299-5p	CLIP-seq
MIRT814183	hsa-miR-3064-5p	CLIP-seq
MIRT2444600	hsa-miR-3134	CLIP-seq
MIRT2444601	hsa-miR-3135b	CLIP-seq
MIRT814137	hsa-miR-3139	CLIP-seq
MIRT2444602	hsa-miR-3146	CLIP-seq
MIRT2444603	hsa-miR-3150b-3p	CLIP-seq
MIRT2444604	hsa-miR-3152-5p	CLIP-seq
MIRT814138	hsa-miR-3153	CLIP-seq
MIRT2444605	hsa-miR-3162-5p	CLIP-seq
MIRT2444606	hsa-miR-3167	CLIP-seq
MIRT2483128	hsa-miR-3173-3p	CLIP-seq
MIRT2675835	hsa-miR-3182	CLIP-seq
MIRT2444607	hsa-miR-342-5p	CLIP-seq
MIRT814190	hsa-miR-3591-3p	CLIP-seq
MIRT2444609	hsa-miR-3614-5p	CLIP-seq
MIRT2179733	hsa-miR-3649	CLIP-seq
MIRT2444612	hsa-miR-3674	CLIP-seq
MIRT2483129	hsa-miR-3689d	CLIP-seq
MIRT1940727	hsa-miR-3714	CLIP-seq
MIRT2483130	hsa-miR-378	CLIP-seq
MIRT2483131	hsa-miR-378b	CLIP-seq
MIRT2483132	hsa-miR-378c	CLIP-seq
MIRT2483133	hsa-miR-378d	CLIP-seq
MIRT2483134	hsa-miR-378e	CLIP-seq
MIRT2483135	hsa-miR-378f	CLIP-seq
MIRT2483136	hsa-miR-378h	CLIP-seq
MIRT2483137	hsa-miR-378i	CLIP-seq
MIRT2483138	hsa-miR-3940-5p	CLIP-seq
MIRT2483139	hsa-miR-409-3p	CLIP-seq
MIRT2483140	hsa-miR-422a	CLIP-seq
MIRT2675836	hsa-miR-4265	CLIP-seq
MIRT814144	hsa-miR-4266	CLIP-seq
MIRT2483142	hsa-miR-4281	CLIP-seq
MIRT2483143	hsa-miR-4286	CLIP-seq
MIRT814200	hsa-miR-4287	CLIP-seq
MIRT814201	hsa-miR-4290	CLIP-seq
MIRT2675837	hsa-miR-4296	CLIP-seq
MIRT1940731	hsa-miR-4301	CLIP-seq
MIRT2444614	hsa-miR-4320	CLIP-seq
MIRT2675838	hsa-miR-4322	CLIP-seq
MIRT2483144	hsa-miR-4328	CLIP-seq
MIRT2675839	hsa-miR-4417	CLIP-seq
MIRT2483146	hsa-miR-4428	CLIP-seq
MIRT2483147	hsa-miR-4434	CLIP-seq
MIRT814203	hsa-miR-4446-5p	CLIP-seq
MIRT2675840	hsa-miR-4464	CLIP-seq
MIRT2483148	hsa-miR-4477b	CLIP-seq
MIRT2483149	hsa-miR-4487	CLIP-seq
MIRT2483150	hsa-miR-4493	CLIP-seq
MIRT1940728	hsa-miR-449c	CLIP-seq
MIRT2483151	hsa-miR-4507	CLIP-seq
MIRT2444615	hsa-miR-450b-3p	CLIP-seq
MIRT2483152	hsa-miR-4516	CLIP-seq
MIRT2444616	hsa-miR-451b	CLIP-seq
MIRT2483153	hsa-miR-4531	CLIP-seq
MIRT814206	hsa-miR-4649-3p	CLIP-seq
MIRT2444617	hsa-miR-4651	CLIP-seq
MIRT2675841	hsa-miR-4652-3p	CLIP-seq
MIRT2444618	hsa-miR-4664-5p	CLIP-seq
MIRT814208	hsa-miR-4667-3p	CLIP-seq
MIRT814210	hsa-miR-4685-3p	CLIP-seq
MIRT814148	hsa-miR-4685-5p	CLIP-seq
MIRT2444619	hsa-miR-4689	CLIP-seq
MIRT2675842	hsa-miR-4691-5p	CLIP-seq
MIRT2444620	hsa-miR-4710	CLIP-seq
MIRT2675843	hsa-miR-4716-5p	CLIP-seq
MIRT2483155	hsa-miR-4724-5p	CLIP-seq
MIRT2444621	hsa-miR-4726-3p	CLIP-seq
MIRT2483156	hsa-miR-4738-3p	CLIP-seq
MIRT2444622	hsa-miR-4739	CLIP-seq
MIRT2675844	hsa-miR-4748	CLIP-seq
MIRT2444623	hsa-miR-4753-3p	CLIP-seq
MIRT814213	hsa-miR-4755-5p	CLIP-seq
MIRT2444624	hsa-miR-4756-5p	CLIP-seq
MIRT2444625	hsa-miR-4768-5p	CLIP-seq
MIRT814157	hsa-miR-4775	CLIP-seq
MIRT2179739	hsa-miR-4778-5p	CLIP-seq
MIRT2444626	hsa-miR-4784	CLIP-seq
MIRT2179740	hsa-miR-4795-3p	CLIP-seq
MIRT2675845	hsa-miR-4797-3p	CLIP-seq
MIRT2179741	hsa-miR-4803	CLIP-seq
MIRT2179742	hsa-miR-499-3p	CLIP-seq
MIRT2179743	hsa-miR-499a-3p	CLIP-seq
MIRT814161	hsa-miR-508-5p	CLIP-seq
MIRT2179745	hsa-miR-513a-5p	CLIP-seq
MIRT2483158	hsa-miR-548b-3p	CLIP-seq
MIRT2675846	hsa-miR-556-3p	CLIP-seq
MIRT2675847	hsa-miR-578	CLIP-seq
MIRT814171	hsa-miR-590-3p	CLIP-seq
MIRT2444627	hsa-miR-608	CLIP-seq
MIRT2483159	hsa-miR-617	CLIP-seq
MIRT2483160	hsa-miR-620	CLIP-seq
MIRT2675848	hsa-miR-630	CLIP-seq
MIRT2444628	hsa-miR-635	CLIP-seq
MIRT814219	hsa-miR-642a	CLIP-seq
MIRT814220	hsa-miR-643	CLIP-seq
MIRT2444629	hsa-miR-654-3p	CLIP-seq
MIRT2675849	hsa-miR-656	CLIP-seq
MIRT2483161	hsa-miR-661	CLIP-seq
MIRT2483162	hsa-miR-662	CLIP-seq
MIRT814172	hsa-miR-708	CLIP-seq
MIRT2444630	hsa-miR-769-3p	CLIP-seq
MIRT814222	hsa-miR-873	CLIP-seq
MIRT2444631	hsa-miR-876-5p	CLIP-seq
MIRT2675850	hsa-miR-942	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
GATA1	Unknown	12815710
NFKB1	Repression	17385716
RELA	Repression	17385716
SP1	Activation	21712774;22275252
SP1	Unknown	15681800;15857888
TFAP2A	Unknown	15059977

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	IPI	16407538
GO:0004175	Function	Endopeptidase activity	IDA	10677483
GO:0004175	Function	Endopeptidase activity	IEA
GO:0004190	Function	Aspartic-type endopeptidase activity	IDA	10531052
GO:0004190	Function	Aspartic-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	10677483, 12901838, 15286784, 15466887, 15886016, 16407538, 16965550, 17573534, 19011241, 20354142, 22709416, 22801501, 23701002, 24612608, 25957769, 26053850, 26840340, 27179792, 29507146, 30538620, 32814053
GO:0005764	Component	Lysosome	IDA	16033761, 23109336, 27084579, 27302062
GO:0005764	Component	Lysosome	IEA
GO:0005768	Component	Endosome	IBA
GO:0005768	Component	Endosome	IDA	10531052
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IDA	15886016, 23109336, 24305806, 27084579, 27302062
GO:0005769	Component	Early endosome	IEA
GO:0005770	Component	Late endosome	IDA	16033761, 23109336, 24612608, 27084579, 27302062
GO:0005770	Component	Late endosome	IEA
GO:0005771	Component	Multivesicular body	IDA	24612608
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005794	Component	Golgi apparatus	IDA	10531052, 11466313, 12586838
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IBA
GO:0005802	Component	Trans-Golgi network	IDA	11466313, 15886016, 23109336
GO:0005802	Component	Trans-Golgi network	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	12586838, 24612608
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10887202
GO:0006508	Process	Proteolysis	IDA	10531052, 10677483
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0006509	Process	Membrane protein ectodomain proteolysis	IBA
GO:0006509	Process	Membrane protein ectodomain proteolysis	IDA	18353773
GO:0006509	Process	Membrane protein ectodomain proteolysis	IEA
GO:0006509	Process	Membrane protein ectodomain proteolysis	TAS	12354787
GO:0008021	Component	Synaptic vesicle	IEA
GO:0008233	Function	Peptidase activity	IDA	8562317
GO:0008233	Function	Peptidase activity	IEA
GO:0008798	Function	Beta-aspartyl-peptidase activity	TAS
GO:0009986	Component	Cell surface	IDA	15886016, 23109336
GO:0009986	Component	Cell surface	IEA
GO:0009986	Component	Cell surface	ISS
GO:0010008	Component	Endosome membrane	TAS
GO:0010288	Process	Response to lead ion	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	10531052
GO:0016485	Process	Protein processing	IDA	10531052
GO:0016787	Function	Hydrolase activity	IEA
GO:0019899	Function	Enzyme binding	IPI	12586838
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0034205	Process	Amyloid-beta formation	IDA	24352696
GO:0042987	Process	Amyloid precursor protein catabolic process	IEA
GO:0042987	Process	Amyloid precursor protein catabolic process	ISS	20704561
GO:0042995	Component	Cell projection	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IGI	29371969
GO:0045121	Component	Membrane raft	IEA
GO:0050435	Process	Amyloid-beta metabolic process	IBA
GO:0050435	Process	Amyloid-beta metabolic process	IDA	10677483, 15080893
GO:0050435	Process	Amyloid-beta metabolic process	IEA
GO:0050435	Process	Amyloid-beta metabolic process	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0050966	Process	Detection of mechanical stimulus involved in sensory perception of pain	IEA
GO:0055037	Component	Recycling endosome	IDA	15886016, 27084579, 27302062
GO:0055037	Component	Recycling endosome	IEA
GO:0060134	Process	Prepulse inhibition	IEA
GO:0070931	Component	Golgi-associated vesicle lumen	TAS
GO:0071280	Process	Cellular response to copper ion	IEA
GO:0071287	Process	Cellular response to manganese ion	IEA
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	IEA
GO:0098793	Component	Presynapse	IEA
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IEA
GO:0120283	Function	Protein serine/threonine kinase binding	IPI	24305806
GO:0140448	Process	Signaling receptor ligand precursor processing	IEA
GO:1904646	Process	Cellular response to amyloid-beta	IEA
GO:1990000	Process	Amyloid fibril formation	TAS

Other IDs

• MIM: 604252
• HGNC: 933
• e!Ensembl: ENSG00000186318

Protein

• UniProt ID: P56817
• Protein name: Beta-secretase 1 (EC 3.4.23.46) (Aspartyl protease 2) (ASP2) (Asp 2) (Beta-site amyloid precursor protein cleaving enzyme 1) (Beta-site APP cleaving enzyme 1) (Memapsin-2) (Membrane-associated aspartic protease 2)
• Protein function: Responsible for the proteolytic processing of the amyloid precursor protein (APP). Cleaves at the N-terminus of the A-beta peptide sequence, between residues 671 and 672 of APP, leads to the generation and extracellular release of beta-cleaved s
• PDB: 1FKN, 1M4H, 1PY1, 1SGZ, 1TQF, 1UJJ, 1UJK, 1W50, 1W51, 1XN2, 1XN3, 1XS7, 1YM2, 1YM4, 2B8L, 2B8V, 2F3E, 2F3F, 2FDP, 2G94, 2HIZ, 2HM1, 2IQG, 2IRZ, 2IS0, 2NTR, 2OAH, 2OF0, 2OHK, 2OHL, 2OHM, 2OHN, 2OHP, 2OHQ, 2OHR, 2OHS, 2OHT, 2OHU, 2P4J, 2P83, 2P8H, 2PH6, 2PH8, 2Q11, 2Q15, 2QK5, 2QMD, 2QMF, 2QMG, 2QP8, 2QU2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00026	Asp	74 → 418	Eukaryotic aspartyl protease	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed at high levels in the brain and pancreas. In the brain, expression is highest in the substantia nigra, locus coruleus and medulla oblongata. {ECO:0000269|PubMed:10677483, ECO:0000269|PubMed:11083922}.
• Sequence:

  MAQALPWLLLWMGAGVLPAHGTQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSF
  VEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSST
  YRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGIL
  GLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLNQSEVLASVGGSMIIGGI
  DHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKK
  VFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRIT
  ILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSAC
  HVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDESTLMTIAYVMAAICALFMLPLCLMVCQW
  RCLRCLRQQHDDFADDISLLK

• Sequence length: 501

Pathways

KEGG:

Alzheimer disease

Reactome:

Amyloid fiber formation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	16407166		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	10677483, 10887202, 10956649, 11423558, 12135764, 14507929, 14978286, 15197182, 15492223, 15615712, 15659232, 15677864, 16181410, 16611980, 17439957, 17699523, 18234899, 19011241, 19302194, 19581486, 20080541, 20236612, 20354142, 22074738, 22303960, 22621900, 22842730, 22879628, 22952813, 23224319, 24352696, 24523906, 24874077, 25359283, 25973041, 25992776, 26228060, 26473367, 26696252, 27302062, 28296235, 28637867, 28668332, 29065581, 29141208, 29348391, 29487280, 29751835, 29859129, 30382187, 30805871, 30968343, 31063584, 31113950, 31547430, 31627825, 31861093, 31936569, 32377715, 32690068, 33439986, 33475074, 34852743, 34958020, 35197498, 36042609, 37047617, 37587672, 38233149, 38570030, 39684911	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	15034149, 21329555, 24332014, 24970022, 25491230, 28359566, 29316899, 33014268	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	23036023	Inhibit	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	10591213, 20080541, 30231670		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	16407166		★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	20164582, 21943123, 26079324		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	11234778, 12707937, 15784960, 17098871, 23750206, 26079324, 27179792, 30231670, 31745860		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	16407166		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	16407166		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	16407166		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	28763060		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	16354928, 16909011, 17258906, 17596707, 20371462, 21289607, 21897006, 22166376, 22709416, 22975420, 23133641, 23951005, 24874077, 25779965, 25973041, 26530776, 26783004, 26897372, 27179792, 28145081, 28158647, 28223223, 28337142, 28413985, 28469554, 29078331, 29161341, 29311632, 29327084, 29331531, 30001606, 30142113, 30249297, 30347431, 30429879, 30519627, 30545942, 30586546, 30692199, 30717208, 30803762, 30873837, 30877973, 30959405, 30970186, 31175888, 31379559, 31379578, 31397505, 31701556, 31711785, 31830091		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	22590542	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28091531		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28091531		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	35915966	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	30686901	Associate	★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	17596707, 28841840, 30729296, 31359452		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	27212113, 34852743	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31760580		★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	30930125		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	30979423	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	37047617	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30805871	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34636395	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31321919		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	21779381		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	21779381		★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	Pubtator	24739782, 25934480	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	25926467, 26661166		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	37552127	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	17553422		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30249297		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	16901640		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	20371462, 25926467, 26062786, 28145081, 29078331, 29491368, 30858603, 31164420, 31601077		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	24332014, 28359566, 31547430, 33475074	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	24332014, 28359566	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	37090740	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22449099, 36087249	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28158647		★☆☆☆☆ Found in Text Mining only
Creutzfeldt-Jakob Disease, Sporadic	Creutzfeldt-Jakob disease	BEFREE	22952813		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	36466876	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative brain disorder	Degenerative Brain Disorder	BEFREE	31424395		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	16901640, 18434550, 23447608, 24935721, 28359566, 28683457, 29788013, 29843245, 31223308, 31496118		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	34828412	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	27138913, 29311632		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27138913, 29311632		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	23596049		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	15473697, 16816111, 17121991, 20080541, 24935721, 29391027		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	16816111, 17293612		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	20080541	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	23595759, 29860633		★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	31834353	Associate	★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	16407166		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	28626014, 29141208, 31496118		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	34828412	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23443094, 24352696		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24352696	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23443094, 24352696		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	20080541	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28158647		★☆☆☆☆ Found in Text Mining only
Hematoma	Hematoma	Pubtator	37552127	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	24739782	Associate	★☆☆☆☆ Found in Text Mining only
Hydrocephalus Normal Pressure	Normal pressure hydrocephalus	Pubtator	34360799	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	23805206		★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	19074428		★☆☆☆☆ Found in Text Mining only
Hypopigmentation disorder	Hypopigmentation Disorder	BEFREE	29613789		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18326038, 26228060	Stimulate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	16904810, 18695942, 19581722, 20089133, 20371462, 20505099, 22275252, 23447608, 24935721, 25926467, 26062786, 28145081, 28739891, 29078331, 29327084, 29491368, 29775888, 30519627, 30596903, 30858603, 31113950, 31164420, 31223308, 31547430, 31601077, 31741224		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myopathy, Sporadic	Inclusion body myopathy	BEFREE	12618121, 20236612		★☆☆☆☆ Found in Text Mining only
Intestinal Volvulus	Intestinal Volvulus	BEFREE	22964044		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	20930286		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31321919		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31363054		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	21779381		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	21779381	Associate	★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	18334538, 20164582, 22728099, 25742200, 28359566, 29788013, 30519627		★☆☆☆☆ Found in Text Mining only
MILES-CARPENTER X-LINKED MENTAL RETARDATION SYNDROME	MILES-CARPENTER X-Linked MENTAL RETARDATION SYNDROME	BEFREE	30427208		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	18413858		★☆☆☆☆ Found in Text Mining only
Multiple System Atrophy	Multiple system atrophy	Pubtator	30968343	Associate	★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	20236612	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	29979789		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	24346801	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16901640, 17075903, 17576410, 19074428, 19885829, 22306812, 22726800, 23257508, 23951005, 24621265, 24874077, 25051175, 25973041, 26092426, 28668332, 28822725, 29743204, 30144352, 30569418, 31063584		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	25491230	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	33383341, 37330543, 37552127	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	25152461, 25724081, 26317805, 27511641, 29751835, 29966870, 30445338, 31766220		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	23443094, 29979789		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31321919		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	12618121		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	27138913, 29311632, 29526536		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	20930286, 25808939		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	35481549	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	29171411		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	16407166		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	16901640, 18434550, 23447608, 24935721, 28359566, 28683457, 29788013, 29843245, 31223308, 31496118		★☆☆☆☆ Found in Text Mining only
Prion Diseases	Prion disease	Pubtator	22952813	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	34852743	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	19536656, 19828790, 20926259, 28035928, 28384043, 28993723, 29500546, 30500411		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	19536656, 20926259		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	38570030	Associate	★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	29595667	Associate	★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	14645205, 16539685, 17409228, 19364929, 20685197, 21329555, 22122349, 22178732, 22926063, 24935721, 27294139, 27883331, 29038004, 29266373, 29679667, 29775888, 30842555, 31114953, 31235739, 31276550		★☆☆☆☆ Found in Text Mining only
Sialic Acid Storage Disease, Finnish Type (disorder)	Sialic Acid Storage Disease	BEFREE	28455102		★☆☆☆☆ Found in Text Mining only
SPINOCEREBELLAR ATAXIA 17	Spinocerebellar Ataxia	BEFREE	22664922		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30805871	Inhibit	★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	30251689		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	18289733		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	29348391	Associate	★☆☆☆☆ Found in Text Mining only