Gene Gene information from NCBI Gene database.
Entrez ID 23608
Gene name Makorin ring finger protein 1
Gene symbol MKRN1
Synonyms (NCBI Gene)
RNF61
Chromosome 7
Chromosome location 7q34
Summary This gene encodes a protein that belongs to a novel class of zinc finger proteins. The encoded protein functions as a transcriptional co-regulator, and as an E3 ubiquitin ligase that promotes the ubiquitination and proteasomal degradation of target protei
miRNA miRNA information provided by mirtarbase database.
522
miRTarBase ID miRNA Experiments Reference
MIRT002511 hsa-miR-373-3p Microarray 15685193
MIRT019801 hsa-miR-375 Microarray 20215506
MIRT002511 hsa-miR-373-3p Microarray 15685193
MIRT051838 hsa-let-7c-5p CLASH 23622248
MIRT048130 hsa-miR-197-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
GO ID Ontology Definition Evidence Reference
GO:0000209 Process Protein polyubiquitination IDA 19536131
GO:0000209 Process Protein polyubiquitination IEA
GO:0003723 Function RNA binding HDA 22658674
GO:0005515 Function Protein binding IPI 19536131, 32296183
GO:0005829 Component Cytosol TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607754 7112 ENSG00000133606
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UHC7
Protein name E3 ubiquitin-protein ligase makorin-1 (EC 2.3.2.27) (RING finger protein 61) (RING-type E3 ubiquitin transferase makorin-1)
Protein function E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. These substrates include FILIP1, p53/TP53, CDKN1A and TERT. Keeps cells alive by suppressing p53/TP53 under normal conditions, but stimulates a
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18044 zf-CCCH_4 59 80 CCCH-type zinc finger Domain
PF00642 zf-CCCH 85 110 Zinc finger C-x8-C-x5-C-x3-H type (and similar) Family
PF18044 zf-CCCH_4 212 233 CCCH-type zinc finger Domain
PF00097 zf-C3HC4 281 334 Zinc finger, C3HC4 type (RING finger) Domain
PF14608 zf-CCCH_2 369 391 Domain
PF15815 MKRN1_C 392 482 E3 ubiquitin-protein ligase makorin, C-terminal Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:10843807, ECO:0000269|PubMed:16785614}.
Sequence
MAEAATPGTTATTSGAGAAAATAAAASPTPIPTVTAPSLGAGGGGGGSDGSGGGWTKQVT
CRYFMHGVCKEGDNCRYSHD
LSDSPYSVVCKYFQRGYCIYGDRCRYEHSKPLKQEEATAT
ELTTKSSLAASSSLSSIVGPLVEMNTGEAESRNSNFATVGAGSEDWVNAIEFVPGQPYCG
RTAPSCTEAPLQGSVTKEESEKEQTAVETKKQLCPYAAVGECRYGENCVYLHGDSCDMCG
LQVLHPMDAAQRSQHIKSCIEAHEKDMELSFAVQRSKDMVCGICMEVVYEKANPSERRFG
ILSNCNHTYCLKCIRKWRSAKQFESKIIKSCPEC
RITSNFVIPSEYWVEEKEEKQKLILK
YKEAMSNKACRYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFW
ELIEERENSNPFDNDEEEVVTFELGEMLLMLLAAGGDDELTDSEDEWDLFHDELEDFYDL
DL
Sequence length 482
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    AKT phosphorylates targets in the cytosol
Regulation of PTEN stability and activity
Antigen processing: Ubiquitination & Proteasome degradation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenomatous Polyposis Coli Multiple polyposis syndrome BEFREE 29713058
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Renal cell carcinoma Pubtator 36938725 Inhibit
★☆☆☆☆
Found in Text Mining only
Cervical Intraepithelial Neoplasia Cervical Intraepithelial Neoplasia BEFREE 26817873
★☆☆☆☆
Found in Text Mining only
Metabolic Syndrome X Metabolic Syndrome BEFREE 30143610
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 22864571, 23104211
★☆☆☆☆
Found in Text Mining only
Non-alcoholic Fatty Liver Disease Non-Alcoholic Fatty Liver Disease BEFREE 30143610
★☆☆☆☆
Found in Text Mining only
Obesity Obesity BEFREE 30143610
★☆☆☆☆
Found in Text Mining only
Thyroid Carcinoma Anaplastic Thyroid cancer Pubtator 26680454 Associate
★☆☆☆☆
Found in Text Mining only
Thyroid Neoplasms Thyroid cancer Pubtator 32737449 Associate
★☆☆☆☆
Found in Text Mining only
Urinary Bladder Neoplasms Urinary bladder neoplasms Pubtator 39742262 Associate
★☆☆☆☆
Found in Text Mining only