DAPK2 (death associated protein kinase 2)

Gene

• Entrez ID: 23604
• Gene name: Death associated protein kinase 2
• Gene symbol: DAPK2
• Synonyms (NCBI Gene): DRP-1, DRP1
• Chromosome: 15
• Chromosome location: 15q22.31
• Summary: This gene encodes a protein that belongs to the serine/threonine protein kinase family. This protein contains a N-terminal protein kinase domain followed by a conserved calmodulin-binding domain with significant similarity to that of death-associated prot

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016960	hsa-miR-335-5p	Microarray	18185580
MIRT545496	hsa-miR-548u	PAR-CLIP	21572407
MIRT545495	hsa-miR-7161-5p	PAR-CLIP	21572407
MIRT545494	hsa-miR-3667-5p	PAR-CLIP	21572407
MIRT545493	hsa-miR-4744	PAR-CLIP	21572407
MIRT545492	hsa-miR-4509	PAR-CLIP	21572407
MIRT545491	hsa-miR-519d-5p	PAR-CLIP	21572407
MIRT545490	hsa-miR-5695	PAR-CLIP	21572407
MIRT545489	hsa-miR-4799-5p	PAR-CLIP	21572407
MIRT545488	hsa-miR-515-5p	PAR-CLIP	21572407
MIRT545487	hsa-miR-519e-5p	PAR-CLIP	21572407
MIRT545485	hsa-miR-4263	PAR-CLIP	21572407
MIRT545486	hsa-miR-576-5p	PAR-CLIP	21572407
MIRT545496	hsa-miR-548u	PAR-CLIP	21572407
MIRT545495	hsa-miR-7161-5p	PAR-CLIP	21572407
MIRT545494	hsa-miR-3667-5p	PAR-CLIP	21572407
MIRT545493	hsa-miR-4744	PAR-CLIP	21572407
MIRT545492	hsa-miR-4509	PAR-CLIP	21572407
MIRT545491	hsa-miR-519d-5p	PAR-CLIP	21572407
MIRT545490	hsa-miR-5695	PAR-CLIP	21572407
MIRT545489	hsa-miR-4799-5p	PAR-CLIP	21572407
MIRT545488	hsa-miR-515-5p	PAR-CLIP	21572407
MIRT545487	hsa-miR-519e-5p	PAR-CLIP	21572407
MIRT545485	hsa-miR-4263	PAR-CLIP	21572407
MIRT545486	hsa-miR-576-5p	PAR-CLIP	21572407
MIRT923164	hsa-miR-122	CLIP-seq
MIRT923165	hsa-miR-1263	CLIP-seq
MIRT923166	hsa-miR-1321	CLIP-seq
MIRT923167	hsa-miR-1912	CLIP-seq
MIRT923168	hsa-miR-2909	CLIP-seq
MIRT923169	hsa-miR-3120-5p	CLIP-seq
MIRT923170	hsa-miR-3145-3p	CLIP-seq
MIRT923171	hsa-miR-3150a-3p	CLIP-seq
MIRT923172	hsa-miR-3162-5p	CLIP-seq
MIRT923173	hsa-miR-3175	CLIP-seq
MIRT923174	hsa-miR-3664-5p	CLIP-seq
MIRT923175	hsa-miR-3689a-5p	CLIP-seq
MIRT923176	hsa-miR-3689b	CLIP-seq
MIRT923177	hsa-miR-3689e	CLIP-seq
MIRT923178	hsa-miR-3689f	CLIP-seq
MIRT923179	hsa-miR-376c	CLIP-seq
MIRT923180	hsa-miR-4463	CLIP-seq
MIRT923181	hsa-miR-4494	CLIP-seq
MIRT923182	hsa-miR-4522	CLIP-seq
MIRT923183	hsa-miR-4536	CLIP-seq
MIRT923184	hsa-miR-4695-3p	CLIP-seq
MIRT923185	hsa-miR-4739	CLIP-seq
MIRT923186	hsa-miR-4756-5p	CLIP-seq
MIRT923187	hsa-miR-4778-5p	CLIP-seq
MIRT923188	hsa-miR-590-3p	CLIP-seq
MIRT923189	hsa-miR-603	CLIP-seq
MIRT923190	hsa-miR-939	CLIP-seq
MIRT923164	hsa-miR-122	CLIP-seq
MIRT923166	hsa-miR-1321	CLIP-seq
MIRT923167	hsa-miR-1912	CLIP-seq
MIRT923168	hsa-miR-2909	CLIP-seq
MIRT923172	hsa-miR-3162-5p	CLIP-seq
MIRT1973518	hsa-miR-4292	CLIP-seq
MIRT1973519	hsa-miR-4308	CLIP-seq
MIRT1973520	hsa-miR-4418	CLIP-seq
MIRT923180	hsa-miR-4463	CLIP-seq
MIRT1973521	hsa-miR-4467	CLIP-seq
MIRT923181	hsa-miR-4494	CLIP-seq
MIRT923184	hsa-miR-4695-3p	CLIP-seq
MIRT923185	hsa-miR-4739	CLIP-seq
MIRT923186	hsa-miR-4756-5p	CLIP-seq
MIRT1973522	hsa-miR-509-3-5p	CLIP-seq
MIRT1973523	hsa-miR-509-5p	CLIP-seq
MIRT923164	hsa-miR-122	CLIP-seq
MIRT2209085	hsa-miR-1237	CLIP-seq
MIRT2209086	hsa-miR-1258	CLIP-seq
MIRT2209087	hsa-miR-1285	CLIP-seq
MIRT2209088	hsa-miR-1324	CLIP-seq
MIRT2209089	hsa-miR-1343	CLIP-seq
MIRT923167	hsa-miR-1912	CLIP-seq
MIRT2209090	hsa-miR-205	CLIP-seq
MIRT2209091	hsa-miR-2861	CLIP-seq
MIRT2209092	hsa-miR-296-5p	CLIP-seq
MIRT2209093	hsa-miR-3125	CLIP-seq
MIRT2209094	hsa-miR-3156-3p	CLIP-seq
MIRT923172	hsa-miR-3162-5p	CLIP-seq
MIRT2209095	hsa-miR-3166	CLIP-seq
MIRT2209096	hsa-miR-3187-5p	CLIP-seq
MIRT2209097	hsa-miR-3607-5p	CLIP-seq
MIRT2209098	hsa-miR-3667-3p	CLIP-seq
MIRT2209099	hsa-miR-378g	CLIP-seq
MIRT2209100	hsa-miR-3916	CLIP-seq
MIRT2209101	hsa-miR-4301	CLIP-seq
MIRT2209102	hsa-miR-4314	CLIP-seq
MIRT1973520	hsa-miR-4418	CLIP-seq
MIRT923180	hsa-miR-4463	CLIP-seq
MIRT2209103	hsa-miR-4486	CLIP-seq
MIRT923181	hsa-miR-4494	CLIP-seq
MIRT923184	hsa-miR-4695-3p	CLIP-seq
MIRT2209104	hsa-miR-4720-3p	CLIP-seq
MIRT2209105	hsa-miR-483-3p	CLIP-seq
MIRT1973522	hsa-miR-509-3-5p	CLIP-seq
MIRT1973523	hsa-miR-509-5p	CLIP-seq
MIRT2209106	hsa-miR-518a-5p	CLIP-seq
MIRT2209107	hsa-miR-527	CLIP-seq
MIRT2209108	hsa-miR-612	CLIP-seq
MIRT2209109	hsa-miR-635	CLIP-seq
MIRT923164	hsa-miR-122	CLIP-seq
MIRT2512967	hsa-miR-129-5p	CLIP-seq
MIRT923167	hsa-miR-1912	CLIP-seq
MIRT2512968	hsa-miR-3149	CLIP-seq
MIRT923180	hsa-miR-4463	CLIP-seq
MIRT923181	hsa-miR-4494	CLIP-seq
MIRT923184	hsa-miR-4695-3p	CLIP-seq
MIRT2512969	hsa-miR-4735-5p	CLIP-seq
MIRT2512970	hsa-miR-4775	CLIP-seq
MIRT2512971	hsa-miR-4794	CLIP-seq
MIRT923188	hsa-miR-590-3p	CLIP-seq
MIRT923164	hsa-miR-122	CLIP-seq
MIRT923167	hsa-miR-1912	CLIP-seq
MIRT923180	hsa-miR-4463	CLIP-seq
MIRT923181	hsa-miR-4494	CLIP-seq
MIRT923184	hsa-miR-4695-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
E2F1	Activation	18521079
KLF6	Activation	18521079
SPI1	Unknown	24038216

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	16756490
GO:0005515	Function	Protein binding	IPI	21408167, 25416956, 31515488, 32296183, 36931259
GO:0005516	Function	Calmodulin binding	IDA	10376525
GO:0005516	Function	Calmodulin binding	IEA
GO:0005524	Function	ATP binding	IDA	10376525
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	10376525, 10629061
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0006468	Process	Protein phosphorylation	IDA	10376525
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	10629061
GO:0010506	Process	Regulation of autophagy	IEA
GO:0010506	Process	Regulation of autophagy	TAS	16756490
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0034423	Component	Autophagosome lumen	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IDA	10376525
GO:0042802	Function	Identical protein binding	IPI	10629061, 11230133
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042981	Process	Regulation of apoptotic process	TAS	16756490
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043276	Process	Anoikis	IMP	18957423
GO:0046777	Process	Protein autophosphorylation	TAS	16756490
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IMP	24163421
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1990266	Process	Neutrophil migration	IEA
GO:2000424	Process	Positive regulation of eosinophil chemotaxis	IMP	24163421
GO:2001242	Process	Regulation of intrinsic apoptotic signaling pathway	IMP	10376525

Other IDs

• MIM: 616567
• HGNC: 2675
• e!Ensembl: ENSG00000035664

Protein

• UniProt ID: Q9UIK4
• Protein name: Death-associated protein kinase 2 (DAP kinase 2) (EC 2.7.11.1) (DAP-kinase-related protein 1) (DRP-1)
• Protein function: Calcium/calmodulin-dependent serine/threonine kinase involved in multiple cellular signaling pathways that trigger cell survival, apoptosis, and autophagy. Regulates both type I apoptotic and type II autophagic cell death signals, depending on t
• PDB: 1WMK, 1WRZ, 1Z9X, 1ZUZ, 1ZWS, 2A27, 2A2A, 2CKE, 6PAW, 7A6R, 7A6Y
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	23 → 285	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in neutrophils and eosinophils (PubMed:24163421). Isoform 2 is expressed in embryonic stem cells (at protein level). Isoform 1 is ubiquitously expressed in all tissue types examined with high levels in heart, lung and skeleta
• Sequence:

  MFQASMRSPNMEPFKQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSR
  ASRRGVSREEIEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKES
  LSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIED
  GVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANIT
  AVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPWITPVDNQQAMVRRESV
  VNLENFRKQYVRRRWKLSFSIVSLCNHLTRSLMKKVHLRPDEDLRNCESDTEEDIARRKA
  LHPRRRSSTS

• Sequence length: 370

Pathways

KEGG:

Autophagy - animal
Pathways in cancer
Bladder cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, PROMYELOCYTIC, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	24038216		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	24038216, 28978663		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	CTD_human_DG	28978663		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	19609235		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	27677309		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	23713734, 29335339		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	40033250	Stimulate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27737949		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27737949		★☆☆☆☆ Found in Text Mining only
ATRICHIA WITH PAPULAR LESIONS	Atrichia With Papular Lesions	BEFREE	24038216, 28978663		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28713932		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	11839665		★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	24758576		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25434519, 25595902, 25982274, 28825723, 29072687, 30425235, 30809096		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33102579	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31770286		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27049921, 27509055, 31409904, 31639424		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	30604255, 30993599		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	28623750		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	28703801		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28607103		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	30148677, 30447185		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28139514		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	37090740	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22487795		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30258050		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32244500	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	24905188, 26915633, 28384228, 30567380, 30938090		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	29223396		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29768513, 29924999		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29768513, 29924999		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31849103		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	28703801		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	25853493, 31063459, 31349216		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	28939434		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	29448246		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	27049921, 27509055		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	35611939	Associate	★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	30171839		★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	31361992		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	26247724		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24899388		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24899388		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27495873		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	24905188, 26915633, 28384228, 30567380, 30938090		★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	29726929		★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	30290401		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	19609235		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	23641925, 29397067, 30449600, 30914652		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	18805504, 28808422, 30444033, 30447185, 31115753		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	32227373	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29563985, 29981304, 30243997, 31346611		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	28190775		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	22511751, 28739174, 29431643, 30042687, 31336911		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28294974		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	22367970, 28432138, 29464060		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	29906559		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29435096		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	27349577, 29890853		★☆☆☆☆ Found in Text Mining only
Lafora Disease	Lafora Disease	BEFREE	28063983		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24038216	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	24038216	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	24038216, 28978663		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27542250, 27653365		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25434519, 25595902, 25982274, 28825723, 29072687, 30425235, 30809096		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30981110		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31770286		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31409904, 31639424		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25658205, 31674061		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31838085		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27683111, 28965855, 30940726		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21527248, 27509055, 29290987, 31127452		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22487795, 29329364		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25174275, 30185782		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	16809610		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	22267603	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29245958, 30425163		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	28131843		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19609235, 24038216, 25595902, 25658205, 26356820, 27542250, 27889261, 28606997, 29360576, 30540939, 30862036		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30801875		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	26518267, 28560384, 28591721		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	23641925, 27830583, 28154157, 28379197, 28409390, 29290987, 31283035		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28981157		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	26038578, 31624314		★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	27491814, 28683400, 28890359, 29092894, 29395086, 29419407		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31409904, 31639424		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25658205, 31674061		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	31412251		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	20164189, 21292769, 22398207, 27267045, 27619562, 28531191, 31308800, 31578315, 31626851		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	36060967	Associate	★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	27831567		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31838085		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30042687, 31336911		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	26119034, 28294974		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	31825802		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	29704468		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29336470		★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	27788485	Associate	★☆☆☆☆ Found in Text Mining only
SPASTIC ATAXIA, CHARLEVOIX-SAGUENAY TYPE	Spastic Ataxia	BEFREE	27288452, 28527629		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	28818497		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28606997, 31127452		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	28479396, 28919853		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27683111, 28965855, 30940726		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12087472		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22160140	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28210956, 28579326		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	35459137	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31138329		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	29924999		★☆☆☆☆ Found in Text Mining only