Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23596
Gene name	Opsin 3
Gene symbol	OPN3
Synonyms (NCBI Gene)	ECPNPPP1R116
Chromosome	1
Chromosome location	1q43
Summary	Opsins are members of the guanine nucleotide-binding protein (G protein)-coupled receptor superfamily. In addition to the visual opsins, mammals possess several photoreceptive non-visual opsins that are expressed in extraocular tissues. This gene, opsin 3

Show/Hide all (60)

miRTarBase ID	miRNA	Experiments	Reference
MIRT047044	hsa-miR-183-5p	CLASH	23622248
MIRT1204414	hsa-miR-1287	CLIP-seq
MIRT1204415	hsa-miR-296-5p	CLIP-seq
MIRT1204416	hsa-miR-3074-5p	CLIP-seq
MIRT1204417	hsa-miR-3135b	CLIP-seq
MIRT1204418	hsa-miR-3167	CLIP-seq
MIRT1204419	hsa-miR-3177-5p	CLIP-seq
MIRT1204420	hsa-miR-3619-3p	CLIP-seq
MIRT1204421	hsa-miR-370	CLIP-seq
MIRT1204422	hsa-miR-377	CLIP-seq
MIRT1204423	hsa-miR-4457	CLIP-seq
MIRT1204424	hsa-miR-4643	CLIP-seq
MIRT1204425	hsa-miR-4776-5p	CLIP-seq
MIRT1204426	hsa-miR-495	CLIP-seq
MIRT1204427	hsa-miR-567	CLIP-seq
MIRT1204428	hsa-miR-624	CLIP-seq
MIRT1204429	hsa-miR-876-5p	CLIP-seq
MIRT2058985	hsa-miR-101	CLIP-seq
MIRT2058986	hsa-miR-1237	CLIP-seq
MIRT2058987	hsa-miR-1248	CLIP-seq
MIRT2058985	hsa-miR-101	CLIP-seq
MIRT2287078	hsa-miR-1275	CLIP-seq
MIRT2287079	hsa-miR-205	CLIP-seq
MIRT2287080	hsa-miR-217	CLIP-seq
MIRT2287081	hsa-miR-299-3p	CLIP-seq
MIRT2287082	hsa-miR-3117-5p	CLIP-seq
MIRT2287083	hsa-miR-3137	CLIP-seq
MIRT2287084	hsa-miR-3153	CLIP-seq
MIRT2287085	hsa-miR-3163	CLIP-seq
MIRT1204419	hsa-miR-3177-5p	CLIP-seq
MIRT1204422	hsa-miR-377	CLIP-seq
MIRT2287086	hsa-miR-4260	CLIP-seq
MIRT2287087	hsa-miR-4271	CLIP-seq
MIRT2287088	hsa-miR-4292	CLIP-seq
MIRT2287089	hsa-miR-4308	CLIP-seq
MIRT2287090	hsa-miR-4418	CLIP-seq
MIRT2287091	hsa-miR-4427	CLIP-seq
MIRT2287092	hsa-miR-4491	CLIP-seq
MIRT2287093	hsa-miR-4525	CLIP-seq
MIRT1204424	hsa-miR-4643	CLIP-seq
MIRT2287094	hsa-miR-4648	CLIP-seq
MIRT2287095	hsa-miR-4654	CLIP-seq
MIRT2287096	hsa-miR-4657	CLIP-seq
MIRT2287097	hsa-miR-4665-5p	CLIP-seq
MIRT2287098	hsa-miR-4668-5p	CLIP-seq
MIRT2287099	hsa-miR-4688	CLIP-seq
MIRT2287100	hsa-miR-4709-5p	CLIP-seq
MIRT2287101	hsa-miR-4723-5p	CLIP-seq
MIRT2287102	hsa-miR-4725-3p	CLIP-seq
MIRT2287103	hsa-miR-4738-3p	CLIP-seq
MIRT2287104	hsa-miR-4769-5p	CLIP-seq
MIRT2287105	hsa-miR-486-3p	CLIP-seq
MIRT2287106	hsa-miR-500a	CLIP-seq
MIRT2287107	hsa-miR-509-3-5p	CLIP-seq
MIRT2287108	hsa-miR-509-5p	CLIP-seq
MIRT1204427	hsa-miR-567	CLIP-seq
MIRT2287109	hsa-miR-625	CLIP-seq
MIRT2287110	hsa-miR-627	CLIP-seq
MIRT2287111	hsa-miR-668	CLIP-seq
MIRT2287112	hsa-miR-924	CLIP-seq

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001750	Component	Photoreceptor outer segment	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	10234000
GO:0005502	Function	11-cis retinal binding	IDA	31097585
GO:0005503	Function	All-trans retinal binding	IDA	31097585
GO:0005515	Function	Protein binding	IPI	31097585
GO:0005737	Component	Cytoplasm	IDA	30168605
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	30168605, 31097585, 31380578, 31730232
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10234000
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10234000
GO:0007602	Process	Phototransduction	IBA
GO:0007602	Process	Phototransduction	IEA
GO:0007602	Process	Phototransduction	NAS	10234000
GO:0008020	Function	G protein-coupled photoreceptor activity	IBA
GO:0008020	Function	G protein-coupled photoreceptor activity	NAS	10234000
GO:0009583	Process	Detection of light stimulus	NAS	10234000
GO:0009584	Process	Detection of visible light	IEA
GO:0009637	Process	Response to blue light	IDA	30168605
GO:0009637	Process	Response to blue light	IEA
GO:0009637	Process	Response to blue light	IMP	28842328
GO:0009881	Function	Photoreceptor activity	IEA
GO:0009881	Function	Photoreceptor activity	NAS	10234000
GO:0009893	Process	Positive regulation of metabolic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	10234000
GO:0030216	Process	Keratinocyte differentiation	IMP	30168605
GO:0042752	Process	Regulation of circadian rhythm	NAS	10234000
GO:0043066	Process	Negative regulation of apoptotic process	IMP	31730232
GO:0046326	Process	Positive regulation of D-glucose import	IEA
GO:0048022	Process	Negative regulation of melanin biosynthetic process	IMP	31097585
GO:0048023	Process	Positive regulation of melanin biosynthetic process	IMP	28842328
GO:0071482	Process	Cellular response to light stimulus	IBA
GO:0071492	Process	Cellular response to UV-A	IDA	31380578
GO:1901857	Process	Positive regulation of cellular respiration	IEA

MIM	HGNC	e!Ensembl
606695	14007	ENSG00000054277

Q9H1Y3

Protein name

Opsin-3 (Encephalopsin) (Panopsin)

Protein function

G-protein coupled receptor which selectively activates G proteins via ultraviolet A (UVA) light-mediated activation in the skin (PubMed:28842328, PubMed:31097585, PubMed:31380578). Binds both 11-cis retinal and all-trans retinal (PubMed:31097585

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	58 → 309	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in tracheal airway smooth muscle (at protein level) (PubMed:30284927). Expressed throughout the epidermis and dermis, predominantly in the basal layer on the facial and abdominal skin (at protein level) (PubMed:30168605). Exp

Sequence

MYSGNRSGGHGYWDGGGAAGAEGPAPAGTLSPAPLFSPGTYERLALLLGSIGLLGVGNNL
LVLVLYYKFQRLRTPTHLLLVNISLSDLLVSLFGVTFTFVSCLRNGWVWDTVGCVWDGFS
GSLFGIVSIATLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYI
LDVHGLGCTVDWKSKDANDSSFVLFLFLGCLVVPLGVIAHCYGHILYSIRMLRCVEDLQT
IQVIKILKYEKKLAKMCFLMIFTFLVCWMPYIVICFLVVNGHGHLVTPTISIVSYLFAKS
NTVYNPVIYVFMIRKFRRSLLQLLCLRLLRCQRPAKDLPAAGSEMQIRPIVMSQKDGDRP
KKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQVRPL

Sequence length

402

Interactions

View interactions

	Reactome
			G alpha (i) signalling events Opsins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT RESISTANT DEPRESSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (15)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31802643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	18344558, 20425513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	18344558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31802643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22313545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	33955704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33955704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus syndrome congenital	Melanocytic nevus	Pubtator	35577105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33955704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	35577105	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29379995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	38243290	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	23006423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	39487504	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	39487504	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

OPN3 (opsin 3)