Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23593
Gene name	Heme binding protein 2
Gene symbol	HEBP2
Synonyms (NCBI Gene)	C6ORF34BC6orf34PP23SOUL
Chromosome	6
Chromosome location	6q24.1
Summary	The protein encoded by this gene is found predominately in the cytoplasm, where it plays a role in the collapse of mitochondrial membrane potential (MMP) prior to necrotic cell death. The encoded protein enhances outer and inner mitochondrial membrane per

Show/Hide all (76)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002643	hsa-miR-124-3p	Microarray	15685193
MIRT002643	hsa-miR-124-3p	Microarray;Other	15685193
MIRT715677	hsa-miR-543	HITS-CLIP	19536157
MIRT715676	hsa-miR-15a-3p	HITS-CLIP	19536157
MIRT715674	hsa-miR-1972	HITS-CLIP	19536157
MIRT715675	hsa-miR-622	HITS-CLIP	19536157
MIRT715673	hsa-miR-6884-3p	HITS-CLIP	19536157
MIRT715672	hsa-miR-6872-3p	HITS-CLIP	19536157
MIRT715671	hsa-miR-5189-3p	HITS-CLIP	19536157
MIRT642179	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT642178	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT642177	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT642176	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT642175	hsa-miR-1285-3p	HITS-CLIP	23824327
MIRT642174	hsa-miR-3187-5p	HITS-CLIP	23824327
MIRT642173	hsa-miR-5189-5p	HITS-CLIP	23824327
MIRT642172	hsa-miR-612	HITS-CLIP	23824327
MIRT642171	hsa-miR-6860	HITS-CLIP	23824327
MIRT642170	hsa-miR-4486	HITS-CLIP	23824327
MIRT642168	hsa-miR-1260a	HITS-CLIP	23824327
MIRT642169	hsa-miR-4314	HITS-CLIP	23824327
MIRT607500	hsa-miR-500b-3p	HITS-CLIP	24906430
MIRT607499	hsa-miR-5693	HITS-CLIP	24906430
MIRT607498	hsa-miR-6773-3p	HITS-CLIP	24906430
MIRT607497	hsa-miR-215-3p	HITS-CLIP	24906430
MIRT607496	hsa-miR-383-5p	HITS-CLIP	24906430
MIRT607495	hsa-miR-4772-5p	HITS-CLIP	24906430
MIRT607494	hsa-miR-6499-3p	HITS-CLIP	24906430
MIRT607493	hsa-miR-3194-3p	HITS-CLIP	24906430
MIRT607492	hsa-miR-3135b	HITS-CLIP	24906430
MIRT607491	hsa-miR-504-3p	HITS-CLIP	24906430
MIRT607490	hsa-miR-122-5p	HITS-CLIP	24906430
MIRT607489	hsa-miR-3622b-5p	HITS-CLIP	24906430
MIRT607488	hsa-miR-3652	HITS-CLIP	24906430
MIRT607487	hsa-miR-4430	HITS-CLIP	24906430
MIRT607486	hsa-miR-6879-3p	HITS-CLIP	24906430
MIRT607485	hsa-miR-143-5p	HITS-CLIP	24906430
MIRT607484	hsa-miR-5691	HITS-CLIP	24906430
MIRT607483	hsa-miR-6805-3p	HITS-CLIP	24906430
MIRT607482	hsa-miR-5698	HITS-CLIP	24906430
MIRT715677	hsa-miR-543	HITS-CLIP	19536157
MIRT715676	hsa-miR-15a-3p	HITS-CLIP	19536157
MIRT715674	hsa-miR-1972	HITS-CLIP	19536157
MIRT715675	hsa-miR-622	HITS-CLIP	19536157
MIRT715673	hsa-miR-6884-3p	HITS-CLIP	19536157
MIRT715672	hsa-miR-6872-3p	HITS-CLIP	19536157
MIRT715671	hsa-miR-5189-3p	HITS-CLIP	19536157
MIRT642179	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT642178	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT642177	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT642176	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT642175	hsa-miR-1285-3p	HITS-CLIP	23824327
MIRT642174	hsa-miR-3187-5p	HITS-CLIP	23824327
MIRT642173	hsa-miR-5189-5p	HITS-CLIP	23824327
MIRT642172	hsa-miR-612	HITS-CLIP	23824327
MIRT642171	hsa-miR-6860	HITS-CLIP	23824327
MIRT642170	hsa-miR-4486	HITS-CLIP	23824327
MIRT642168	hsa-miR-1260a	HITS-CLIP	23824327
MIRT642169	hsa-miR-4314	HITS-CLIP	23824327
MIRT1043343	hsa-miR-1252	CLIP-seq
MIRT1043344	hsa-miR-2052	CLIP-seq
MIRT1043345	hsa-miR-297	CLIP-seq
MIRT1043346	hsa-miR-3173-3p	CLIP-seq
MIRT1043347	hsa-miR-3668	CLIP-seq
MIRT1043348	hsa-miR-3935	CLIP-seq
MIRT1043349	hsa-miR-4307	CLIP-seq
MIRT1043350	hsa-miR-4779	CLIP-seq
MIRT1043351	hsa-miR-4796-5p	CLIP-seq
MIRT1043352	hsa-miR-513a-3p	CLIP-seq
MIRT1043353	hsa-miR-567	CLIP-seq
MIRT1043354	hsa-miR-577	CLIP-seq
MIRT2009285	hsa-miR-1278	CLIP-seq
MIRT2241712	hsa-miR-3117-5p	CLIP-seq
MIRT2241713	hsa-miR-4704-5p	CLIP-seq
MIRT2451079	hsa-miR-548u	CLIP-seq
MIRT2451079	hsa-miR-548u	CLIP-seq

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 21639858, 25416956, 27784779, 32296183, 35271311
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	17098234
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	17098234
GO:0005739	Component	Mitochondrion	IEA
GO:0020037	Function	Heme binding	IBA
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0070062	Component	Extracellular exosome	HDA	19056867

MIM	HGNC	e!Ensembl
605825	15716	ENSG00000051620

Q9Y5Z4

Protein name

Heme-binding protein 2 (Placental protein 23) (PP23) (Protein SOUL)

Protein function

Can promote mitochondrial permeability transition and facilitate necrotic cell death under different types of stress conditions.

PDB

3R85 , 3R8J , 3R8K , 4AYZ , 4B0Y , 5GQQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04832	SOUL	20 → 195	SOUL heme-binding protein	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in placenta. {ECO:0000269|PubMed:2018407}.

Sequence

MAEPLQPDPGAAEDAAAQAVETPGWKAPEDAGPQPGSYEIRHYGPAKWVSTSVESMDWDS
AIQTGFTKLNSYIQGKNEKEMKIKMTAPVTSYVEPGSGPFSESTITISLYIPSEQQFDPP
RPLESDVFIEDRAEMTVFVRSFDGFSSAQKNQEQLLTLASILREDGKVFDEKVYYTAGYN
SPVKLLNRNNEVWLIQKNEPTKENE

Sequence length

205

Interactions

View interactions

	Reactome
			Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LIVER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma of lung	Lung carcinoma	BEFREE	28004381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	35767190	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	25058030		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	25058030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28004381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28004381		★★★★★ ★☆☆☆☆ Found in Text Mining only

HEBP2 (heme binding protein 2)