Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2359
Gene name	Formyl peptide receptor 3
Gene symbol	FPR3
Synonyms (NCBI Gene)	FML2_HUMANFMLP-R-IIFMLPYFPRH1FPRH2FPRL2RMLP-R-I
Chromosome	19
Chromosome location	19q13.41

Show/Hide all (63)

miRTarBase ID	miRNA	Experiments	Reference
MIRT614160	hsa-miR-3912-3p	HITS-CLIP	23824327
MIRT611085	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611084	hsa-miR-572	HITS-CLIP	23824327
MIRT611083	hsa-miR-718	HITS-CLIP	23824327
MIRT611085	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611084	hsa-miR-572	HITS-CLIP	23824327
MIRT611083	hsa-miR-718	HITS-CLIP	23824327
MIRT614160	hsa-miR-3912-3p	HITS-CLIP	23824327
MIRT611085	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611084	hsa-miR-572	HITS-CLIP	23824327
MIRT611083	hsa-miR-718	HITS-CLIP	23824327
MIRT614160	hsa-miR-3912-3p	HITS-CLIP	23824327
MIRT611085	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611084	hsa-miR-572	HITS-CLIP	23824327
MIRT611083	hsa-miR-718	HITS-CLIP	23824327
MIRT611085	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611084	hsa-miR-572	HITS-CLIP	23824327
MIRT611083	hsa-miR-718	HITS-CLIP	23824327
MIRT614160	hsa-miR-3912-3p	HITS-CLIP	23824327
MIRT611085	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611084	hsa-miR-572	HITS-CLIP	23824327
MIRT611083	hsa-miR-718	HITS-CLIP	23824327
MIRT611085	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611084	hsa-miR-572	HITS-CLIP	23824327
MIRT611083	hsa-miR-718	HITS-CLIP	23824327
MIRT614160	hsa-miR-3912-3p	HITS-CLIP	23824327
MIRT611085	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611084	hsa-miR-572	HITS-CLIP	23824327
MIRT611083	hsa-miR-718	HITS-CLIP	23824327
MIRT614160	hsa-miR-3912-3p	HITS-CLIP	23824327
MIRT611085	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611084	hsa-miR-572	HITS-CLIP	23824327
MIRT611083	hsa-miR-718	HITS-CLIP	23824327
MIRT611085	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611084	hsa-miR-572	HITS-CLIP	23824327
MIRT611083	hsa-miR-718	HITS-CLIP	23824327
MIRT1003965	hsa-miR-1	CLIP-seq
MIRT1003966	hsa-miR-141	CLIP-seq
MIRT1003967	hsa-miR-200a	CLIP-seq
MIRT1003968	hsa-miR-206	CLIP-seq
MIRT1003969	hsa-miR-3673	CLIP-seq
MIRT1003970	hsa-miR-3690	CLIP-seq
MIRT1003971	hsa-miR-4254	CLIP-seq
MIRT1003972	hsa-miR-4501	CLIP-seq
MIRT1003973	hsa-miR-4793-5p	CLIP-seq
MIRT1003974	hsa-miR-613	CLIP-seq
MIRT1997577	hsa-miR-3682-5p	CLIP-seq
MIRT1997578	hsa-miR-4528	CLIP-seq
MIRT2388174	hsa-miR-217	CLIP-seq
MIRT2388175	hsa-miR-219-5p	CLIP-seq
MIRT2388176	hsa-miR-3126-3p	CLIP-seq
MIRT2388177	hsa-miR-323-5p	CLIP-seq
MIRT2388178	hsa-miR-3682-3p	CLIP-seq
MIRT2388179	hsa-miR-4445	CLIP-seq
MIRT2388180	hsa-miR-4477a	CLIP-seq
MIRT2388181	hsa-miR-4490	CLIP-seq
MIRT2388182	hsa-miR-4699-3p	CLIP-seq
MIRT2388183	hsa-miR-4738-3p	CLIP-seq
MIRT2388184	hsa-miR-4774-5p	CLIP-seq
MIRT2388185	hsa-miR-4781-3p	CLIP-seq
MIRT2388186	hsa-miR-4782-3p	CLIP-seq
MIRT2388187	hsa-miR-508-3p	CLIP-seq
MIRT2388188	hsa-miR-876-3p	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002430	Process	Complement receptor mediated signaling pathway	IBA
GO:0004875	Function	Complement receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004982	Function	N-formyl peptide receptor activity	IBA
GO:0004982	Function	N-formyl peptide receptor activity	TAS	8198572
GO:0005515	Function	Protein binding	IPI	15465011
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8198572
GO:0006935	Process	Chemotaxis	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0007154	Process	Cell communication	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	8198572
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	8198572
GO:0023052	Process	Signaling	IEA

MIM	HGNC	e!Ensembl
136539	3828	ENSG00000187474

P25089

Protein name

N-formyl peptide receptor 3 (FMLP-related receptor II) (FMLP-R-II) (Formyl peptide receptor-like 2)

Protein function

Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophils chemotactic factors. Binding of FMLP to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidyli

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	43 → 302	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in various tissues with highest expression in lung. {ECO:0000269|PubMed:15465011}.

Sequence

METNFSIPLNETEEVLPEPAGHTVLWIFSLLVHGVTFVFGVLGNGLVIWVAGFRMTRTVN
TICYLNLALADFSFSAILPFRMVSVAMREKWPFGSFLCKLVHVMIDINLFVSVYLITIIA
LDRCICVLHPAWAQNHRTMSLAKRVMTGLWIFTIVLTLPNFIFWTTISTTNGDTYCIFNF
AFWGDTAVERLNVFITMAKVFLILHFIIGFSVPMSIITVCYGIIAAKIHRNHMIKSSRPL
RVFAAVVASFFICWFPYELIGILMAVWLKEMLLNGKYKIILVLINPTSSLAFFNSCLNPI
LYVFMGRNFQERLIRSLPTSLERALTEVPDSAQTSNTDTTSASPPEETELQAM

Sequence length

353

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Neutrophil extracellular trap formation Staphylococcus aureus infection		G alpha (i) signalling events Formyl peptide receptors bind formyl peptides and many other ligands

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (13)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	28351365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29364475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29364475	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	24838153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	34735495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	GWASCAT_DG	30818990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33408717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	31116781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25263443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29364475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29544524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	31116781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	31116781		★★★★★ ★☆☆☆☆ Found in Text Mining only

FPR3 (formyl peptide receptor 3)