Gene Gene information from NCBI Gene database.
Entrez ID 23589
Gene name Calcium regulated heat stable protein 1
Gene symbol CARHSP1
Synonyms (NCBI Gene)
CRHSP-24CRHSP24CSDC1
Chromosome 16
Chromosome location 16p13.2
miRNA miRNA information provided by mirtarbase database.
263
miRTarBase ID miRNA Experiments Reference
MIRT001645 hsa-let-7b-5p pSILAC 18668040
MIRT020567 hsa-miR-155-5p Reporter assay;Other 20584899
MIRT001645 hsa-let-7b-5p Proteomics;Other 18668040
MIRT052503 hsa-let-7a-5p CLASH 23622248
MIRT052503 hsa-let-7a-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
GO ID Ontology Definition Evidence Reference
GO:0000177 Component Cytoplasmic exosome (RNase complex) IEA
GO:0000177 Component Cytoplasmic exosome (RNase complex) ISS
GO:0000932 Component P-body IEA
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
616885 17150 ENSG00000153048
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y2V2
Protein name Calcium-regulated heat-stable protein 1 (Calcium-regulated heat-stable protein of 24 kDa) (CRHSP-24)
Protein function Binds mRNA and regulates the stability of target mRNA. Binds single-stranded DNA (in vitro).
PDB 3AQQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00313 CSD 63 129 Domain
Sequence
MSSEPPPPPQPPTHQASVGLLDTPRSRERSPSPLRGNVVPSPLPTRRTRTFSATVRASQG
PVYKGVCKCFCRSKGHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYKMCSIPPKNEK
LQAVEVVIT
HLAPGTKHETWSGHVISS
Sequence length 147
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BRAIN ANEURYSM GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alzheimer Disease Alzheimer disease Pubtator 34937778 Associate
★☆☆☆☆
Found in Text Mining only
Arteriosclerosis Arteriosclerosis BEFREE 26899994
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Atherosclerosis BEFREE 26899994
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Atherosclerosis Pubtator 26899994 Associate
★☆☆☆☆
Found in Text Mining only
Glioblastoma Glioblastoma Pubtator 34290231 Stimulate
★☆☆☆☆
Found in Text Mining only
Infertility Male Male infertility Pubtator 34604380 Associate
★☆☆☆☆
Found in Text Mining only
Intracranial Aneurysm Intracranial Aneurysm GWASCAT_DG 29531279
★☆☆☆☆
Found in Text Mining only
Lewy Body Disease Lewy body disease Pubtator 34937778 Associate
★☆☆☆☆
Found in Text Mining only