RIGI (RNA sensor RIG-I)

Gene

• Entrez ID: 23586
• Gene name: RNA sensor RIG-I
• Gene symbol: RIGI
• Synonyms (NCBI Gene): DDX58, RIG-I, RIG1, RLR-1, SGMRT2
• Chromosome: 9
• Chromosome location: 9p21.1

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs786204847	T>G	Pathogenic	Coding sequence variant, missense variant
rs786204848	C>A	Pathogenic	Coding sequence variant, missense variant
rs1064795754	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1131691305	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1587586052	T>A	Likely-pathogenic	Missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT437784	hsa-miR-10b-5p	Luciferase reporter assay	25312779
MIRT440833	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440833	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT734373	hsa-miR-579-3p	ELISA, Luciferase reporter assay, RNA-seq, Western blotting	32209695
MIRT734374	hsa-miR-221-3p	ELISA, Luciferase reporter assay, RNA-seq, Western blotting	32209695
MIRT735668	hsa-miR-149-5p	Luciferase reporter assay, Western blotting, qRT-PCR	32232013
MIRT931301	hsa-miR-101	CLIP-seq
MIRT931302	hsa-miR-1262	CLIP-seq
MIRT931303	hsa-miR-127-5p	CLIP-seq
MIRT931304	hsa-miR-1293	CLIP-seq
MIRT931305	hsa-miR-142-5p	CLIP-seq
MIRT931306	hsa-miR-144	CLIP-seq
MIRT931307	hsa-miR-146a	CLIP-seq
MIRT931308	hsa-miR-146b-5p	CLIP-seq
MIRT931309	hsa-miR-186	CLIP-seq
MIRT931310	hsa-miR-2681	CLIP-seq
MIRT931311	hsa-miR-298	CLIP-seq
MIRT931312	hsa-miR-3133	CLIP-seq
MIRT931313	hsa-miR-3144-5p	CLIP-seq
MIRT931314	hsa-miR-3150b-3p	CLIP-seq
MIRT931315	hsa-miR-3154	CLIP-seq
MIRT931316	hsa-miR-3163	CLIP-seq
MIRT931317	hsa-miR-3179	CLIP-seq
MIRT931318	hsa-miR-3188	CLIP-seq
MIRT931319	hsa-miR-3191	CLIP-seq
MIRT931320	hsa-miR-3200-3p	CLIP-seq
MIRT931321	hsa-miR-340	CLIP-seq
MIRT931322	hsa-miR-3651	CLIP-seq
MIRT931323	hsa-miR-3664-3p	CLIP-seq
MIRT931324	hsa-miR-4271	CLIP-seq
MIRT931325	hsa-miR-4483	CLIP-seq
MIRT931326	hsa-miR-4496	CLIP-seq
MIRT931327	hsa-miR-4652-5p	CLIP-seq
MIRT931328	hsa-miR-4666-5p	CLIP-seq
MIRT931329	hsa-miR-4689	CLIP-seq
MIRT931330	hsa-miR-4695-3p	CLIP-seq
MIRT931331	hsa-miR-4695-5p	CLIP-seq
MIRT931332	hsa-miR-4701-3p	CLIP-seq
MIRT931333	hsa-miR-4711-5p	CLIP-seq
MIRT931334	hsa-miR-4725-3p	CLIP-seq
MIRT931335	hsa-miR-4729	CLIP-seq
MIRT931336	hsa-miR-4784	CLIP-seq
MIRT931337	hsa-miR-491-5p	CLIP-seq
MIRT931338	hsa-miR-545	CLIP-seq
MIRT931339	hsa-miR-548aa	CLIP-seq
MIRT931340	hsa-miR-548c-3p	CLIP-seq
MIRT931341	hsa-miR-583	CLIP-seq
MIRT931342	hsa-miR-589	CLIP-seq
MIRT931343	hsa-miR-873	CLIP-seq
MIRT1975611	hsa-miR-374a	CLIP-seq
MIRT1975612	hsa-miR-374b	CLIP-seq
MIRT1975613	hsa-miR-4450	CLIP-seq
MIRT1975614	hsa-miR-4643	CLIP-seq
MIRT1975615	hsa-miR-4684-5p	CLIP-seq
MIRT1975616	hsa-miR-4717-3p	CLIP-seq
MIRT1975617	hsa-miR-4733-5p	CLIP-seq
MIRT1975618	hsa-miR-4760-3p	CLIP-seq
MIRT1975619	hsa-miR-498	CLIP-seq
MIRT1975620	hsa-miR-642b	CLIP-seq
MIRT1975621	hsa-miR-656	CLIP-seq
MIRT931301	hsa-miR-101	CLIP-seq
MIRT2211110	hsa-miR-1245b-3p	CLIP-seq
MIRT931302	hsa-miR-1262	CLIP-seq
MIRT2211111	hsa-miR-1271	CLIP-seq
MIRT2211112	hsa-miR-1290	CLIP-seq
MIRT931304	hsa-miR-1293	CLIP-seq
MIRT931306	hsa-miR-144	CLIP-seq
MIRT931307	hsa-miR-146a	CLIP-seq
MIRT931308	hsa-miR-146b-5p	CLIP-seq
MIRT2211113	hsa-miR-1470	CLIP-seq
MIRT2211114	hsa-miR-182	CLIP-seq
MIRT2211115	hsa-miR-1915	CLIP-seq
MIRT931313	hsa-miR-3144-5p	CLIP-seq
MIRT931316	hsa-miR-3163	CLIP-seq
MIRT2211116	hsa-miR-3167	CLIP-seq
MIRT931319	hsa-miR-3191	CLIP-seq
MIRT931321	hsa-miR-340	CLIP-seq
MIRT2211117	hsa-miR-3680	CLIP-seq
MIRT2211118	hsa-miR-3681	CLIP-seq
MIRT2211119	hsa-miR-3692	CLIP-seq
MIRT1975611	hsa-miR-374a	CLIP-seq
MIRT1975612	hsa-miR-374b	CLIP-seq
MIRT2211120	hsa-miR-3925-5p	CLIP-seq
MIRT2211121	hsa-miR-4270	CLIP-seq
MIRT2211122	hsa-miR-4287	CLIP-seq
MIRT2211123	hsa-miR-4311	CLIP-seq
MIRT2211124	hsa-miR-4441	CLIP-seq
MIRT1975613	hsa-miR-4450	CLIP-seq
MIRT931325	hsa-miR-4483	CLIP-seq
MIRT2211125	hsa-miR-4637	CLIP-seq
MIRT1975614	hsa-miR-4643	CLIP-seq
MIRT931327	hsa-miR-4652-5p	CLIP-seq
MIRT931328	hsa-miR-4666-5p	CLIP-seq
MIRT2211126	hsa-miR-4667-3p	CLIP-seq
MIRT2211127	hsa-miR-4685-3p	CLIP-seq
MIRT931330	hsa-miR-4695-3p	CLIP-seq
MIRT931332	hsa-miR-4701-3p	CLIP-seq
MIRT2211128	hsa-miR-4705	CLIP-seq
MIRT1975616	hsa-miR-4717-3p	CLIP-seq
MIRT1975617	hsa-miR-4733-5p	CLIP-seq
MIRT1975618	hsa-miR-4760-3p	CLIP-seq
MIRT2211129	hsa-miR-4773	CLIP-seq
MIRT2211130	hsa-miR-4780	CLIP-seq
MIRT2211131	hsa-miR-4802-3p	CLIP-seq
MIRT931337	hsa-miR-491-5p	CLIP-seq
MIRT2211132	hsa-miR-514	CLIP-seq
MIRT2211133	hsa-miR-514b-3p	CLIP-seq
MIRT931339	hsa-miR-548aa	CLIP-seq
MIRT2211134	hsa-miR-549	CLIP-seq
MIRT931342	hsa-miR-589	CLIP-seq
MIRT2211135	hsa-miR-623	CLIP-seq
MIRT1975620	hsa-miR-642b	CLIP-seq
MIRT2211136	hsa-miR-876-5p	CLIP-seq
MIRT2211137	hsa-miR-885-3p	CLIP-seq
MIRT2211138	hsa-miR-922	CLIP-seq
MIRT2211139	hsa-miR-96	CLIP-seq
MIRT2386823	hsa-miR-1244	CLIP-seq
MIRT2386824	hsa-miR-128	CLIP-seq
MIRT2386825	hsa-miR-139-5p	CLIP-seq
MIRT2386826	hsa-miR-27a	CLIP-seq
MIRT2386827	hsa-miR-27b	CLIP-seq
MIRT2386828	hsa-miR-31	CLIP-seq
MIRT2386829	hsa-miR-3120-3p	CLIP-seq
MIRT2386830	hsa-miR-3138	CLIP-seq
MIRT2211119	hsa-miR-3692	CLIP-seq
MIRT2211120	hsa-miR-3925-5p	CLIP-seq
MIRT2386831	hsa-miR-4436b-3p	CLIP-seq
MIRT2386832	hsa-miR-4520a-3p	CLIP-seq
MIRT1975616	hsa-miR-4717-3p	CLIP-seq
MIRT2386833	hsa-miR-4761-3p	CLIP-seq
MIRT2386834	hsa-miR-618	CLIP-seq
MIRT2386835	hsa-miR-633	CLIP-seq
MIRT2211110	hsa-miR-1245b-3p	CLIP-seq
MIRT2386824	hsa-miR-128	CLIP-seq
MIRT2386826	hsa-miR-27a	CLIP-seq
MIRT2386827	hsa-miR-27b	CLIP-seq
MIRT931314	hsa-miR-3150b-3p	CLIP-seq
MIRT2448135	hsa-miR-362-5p	CLIP-seq
MIRT2211119	hsa-miR-3692	CLIP-seq
MIRT931329	hsa-miR-4689	CLIP-seq
MIRT931331	hsa-miR-4695-5p	CLIP-seq
MIRT1975616	hsa-miR-4717-3p	CLIP-seq
MIRT931336	hsa-miR-4784	CLIP-seq
MIRT2448136	hsa-miR-500b	CLIP-seq
MIRT2448137	hsa-miR-501-5p	CLIP-seq
MIRT2514942	hsa-miR-1178	CLIP-seq
MIRT2514943	hsa-miR-1226	CLIP-seq
MIRT2211110	hsa-miR-1245b-3p	CLIP-seq
MIRT2514944	hsa-miR-1257	CLIP-seq
MIRT2514945	hsa-miR-1261	CLIP-seq
MIRT931302	hsa-miR-1262	CLIP-seq
MIRT2514946	hsa-miR-1264	CLIP-seq
MIRT2514947	hsa-miR-1267	CLIP-seq
MIRT2514948	hsa-miR-1283	CLIP-seq
MIRT931304	hsa-miR-1293	CLIP-seq
MIRT2514949	hsa-miR-1297	CLIP-seq
MIRT2514950	hsa-miR-1321	CLIP-seq
MIRT931307	hsa-miR-146a	CLIP-seq
MIRT931308	hsa-miR-146b-5p	CLIP-seq
MIRT2514951	hsa-miR-148a	CLIP-seq
MIRT2514952	hsa-miR-148b	CLIP-seq
MIRT2514953	hsa-miR-149	CLIP-seq
MIRT2514954	hsa-miR-152	CLIP-seq
MIRT2514955	hsa-miR-181a	CLIP-seq
MIRT2514956	hsa-miR-181b	CLIP-seq
MIRT2514957	hsa-miR-181c	CLIP-seq
MIRT2514958	hsa-miR-181d	CLIP-seq
MIRT2514959	hsa-miR-1827	CLIP-seq
MIRT2514960	hsa-miR-183	CLIP-seq
MIRT2514961	hsa-miR-1910	CLIP-seq
MIRT2514962	hsa-miR-194	CLIP-seq
MIRT2514963	hsa-miR-219-2-3p	CLIP-seq
MIRT2514964	hsa-miR-2467-5p	CLIP-seq
MIRT931310	hsa-miR-2681	CLIP-seq
MIRT2514965	hsa-miR-26a	CLIP-seq
MIRT2514966	hsa-miR-26b	CLIP-seq
MIRT931311	hsa-miR-298	CLIP-seq
MIRT2514967	hsa-miR-3064-5p	CLIP-seq
MIRT2386828	hsa-miR-31	CLIP-seq
MIRT2514968	hsa-miR-3119	CLIP-seq
MIRT2514969	hsa-miR-3121-3p	CLIP-seq
MIRT2514970	hsa-miR-3130-3p	CLIP-seq
MIRT931313	hsa-miR-3144-5p	CLIP-seq
MIRT931315	hsa-miR-3154	CLIP-seq
MIRT931316	hsa-miR-3163	CLIP-seq
MIRT2514971	hsa-miR-3171	CLIP-seq
MIRT2514972	hsa-miR-3173-3p	CLIP-seq
MIRT931317	hsa-miR-3179	CLIP-seq
MIRT931318	hsa-miR-3188	CLIP-seq
MIRT931319	hsa-miR-3191	CLIP-seq
MIRT2514973	hsa-miR-3200-5p	CLIP-seq
MIRT2514974	hsa-miR-326	CLIP-seq
MIRT2514975	hsa-miR-330-5p	CLIP-seq
MIRT2514976	hsa-miR-3607-3p	CLIP-seq
MIRT2514977	hsa-miR-3612	CLIP-seq
MIRT2448135	hsa-miR-362-5p	CLIP-seq
MIRT2514978	hsa-miR-3646	CLIP-seq
MIRT931322	hsa-miR-3651	CLIP-seq
MIRT2514979	hsa-miR-3662	CLIP-seq
MIRT2514980	hsa-miR-3670	CLIP-seq
MIRT2514981	hsa-miR-3671	CLIP-seq
MIRT2514982	hsa-miR-3686	CLIP-seq
MIRT1975611	hsa-miR-374a	CLIP-seq
MIRT1975612	hsa-miR-374b	CLIP-seq
MIRT2514983	hsa-miR-3908	CLIP-seq
MIRT2211120	hsa-miR-3925-5p	CLIP-seq
MIRT2514984	hsa-miR-3934	CLIP-seq
MIRT2514985	hsa-miR-3942-5p	CLIP-seq
MIRT2514986	hsa-miR-3975	CLIP-seq
MIRT2514987	hsa-miR-4251	CLIP-seq
MIRT2514988	hsa-miR-4262	CLIP-seq
MIRT931324	hsa-miR-4271	CLIP-seq
MIRT2211123	hsa-miR-4311	CLIP-seq
MIRT2514989	hsa-miR-4329	CLIP-seq
MIRT2514990	hsa-miR-4419a	CLIP-seq
MIRT2386831	hsa-miR-4436b-3p	CLIP-seq
MIRT2514991	hsa-miR-4446-5p	CLIP-seq
MIRT1975613	hsa-miR-4450	CLIP-seq
MIRT2514992	hsa-miR-4462	CLIP-seq
MIRT2514993	hsa-miR-4465	CLIP-seq
MIRT931325	hsa-miR-4483	CLIP-seq
MIRT2514994	hsa-miR-4494	CLIP-seq
MIRT931326	hsa-miR-4496	CLIP-seq
MIRT2514995	hsa-miR-4510	CLIP-seq
MIRT2514996	hsa-miR-4522	CLIP-seq
MIRT2514997	hsa-miR-4528	CLIP-seq
MIRT2514998	hsa-miR-455-3p	CLIP-seq
MIRT1975614	hsa-miR-4643	CLIP-seq
MIRT931327	hsa-miR-4652-5p	CLIP-seq
MIRT2514999	hsa-miR-4662a-5p	CLIP-seq
MIRT931328	hsa-miR-4666-5p	CLIP-seq
MIRT2515000	hsa-miR-4690-5p	CLIP-seq
MIRT2515001	hsa-miR-4693-3p	CLIP-seq
MIRT931330	hsa-miR-4695-3p	CLIP-seq
MIRT931332	hsa-miR-4701-3p	CLIP-seq
MIRT2515002	hsa-miR-4703-5p	CLIP-seq
MIRT2515003	hsa-miR-4709-3p	CLIP-seq
MIRT2515004	hsa-miR-4712-3p	CLIP-seq
MIRT1975616	hsa-miR-4717-3p	CLIP-seq
MIRT931334	hsa-miR-4725-3p	CLIP-seq
MIRT2515005	hsa-miR-4733-3p	CLIP-seq
MIRT2515006	hsa-miR-4739	CLIP-seq
MIRT2515007	hsa-miR-4742-5p	CLIP-seq
MIRT2515008	hsa-miR-4756-5p	CLIP-seq
MIRT1975618	hsa-miR-4760-3p	CLIP-seq
MIRT2386833	hsa-miR-4761-3p	CLIP-seq
MIRT2515009	hsa-miR-4766-3p	CLIP-seq
MIRT2515010	hsa-miR-4768-5p	CLIP-seq
MIRT2211129	hsa-miR-4773	CLIP-seq
MIRT2515011	hsa-miR-4775	CLIP-seq
MIRT2515012	hsa-miR-4794	CLIP-seq
MIRT2211131	hsa-miR-4802-3p	CLIP-seq
MIRT2515013	hsa-miR-485-5p	CLIP-seq
MIRT931337	hsa-miR-491-5p	CLIP-seq
MIRT1975619	hsa-miR-498	CLIP-seq
MIRT2515014	hsa-miR-499a-5p	CLIP-seq
MIRT2448136	hsa-miR-500b	CLIP-seq
MIRT2448137	hsa-miR-501-5p	CLIP-seq
MIRT2515015	hsa-miR-510	CLIP-seq
MIRT2515016	hsa-miR-512-3p	CLIP-seq
MIRT2515017	hsa-miR-512-5p	CLIP-seq
MIRT2515018	hsa-miR-522	CLIP-seq
MIRT931339	hsa-miR-548aa	CLIP-seq
MIRT2515019	hsa-miR-548ac	CLIP-seq
MIRT931340	hsa-miR-548c-3p	CLIP-seq
MIRT2515020	hsa-miR-548d-3p	CLIP-seq
MIRT2515021	hsa-miR-548z	CLIP-seq
MIRT2515022	hsa-miR-556-5p	CLIP-seq
MIRT2515023	hsa-miR-574-5p	CLIP-seq
MIRT2515024	hsa-miR-576-5p	CLIP-seq
MIRT931342	hsa-miR-589	CLIP-seq
MIRT2515025	hsa-miR-590-3p	CLIP-seq
MIRT2515026	hsa-miR-600	CLIP-seq
MIRT2386835	hsa-miR-633	CLIP-seq
MIRT1975620	hsa-miR-642b	CLIP-seq
MIRT2515027	hsa-miR-650	CLIP-seq
MIRT2515028	hsa-miR-653	CLIP-seq
MIRT2515029	hsa-miR-767-3p	CLIP-seq
MIRT2515030	hsa-miR-767-5p	CLIP-seq
MIRT2211137	hsa-miR-885-3p	CLIP-seq
MIRT2211138	hsa-miR-922	CLIP-seq
MIRT2514942	hsa-miR-1178	CLIP-seq
MIRT2514943	hsa-miR-1226	CLIP-seq
MIRT2211110	hsa-miR-1245b-3p	CLIP-seq
MIRT2514944	hsa-miR-1257	CLIP-seq
MIRT2514945	hsa-miR-1261	CLIP-seq
MIRT931302	hsa-miR-1262	CLIP-seq
MIRT2514946	hsa-miR-1264	CLIP-seq
MIRT2514947	hsa-miR-1267	CLIP-seq
MIRT2514948	hsa-miR-1283	CLIP-seq
MIRT931304	hsa-miR-1293	CLIP-seq
MIRT2514949	hsa-miR-1297	CLIP-seq
MIRT2514950	hsa-miR-1321	CLIP-seq
MIRT931307	hsa-miR-146a	CLIP-seq
MIRT931308	hsa-miR-146b-5p	CLIP-seq
MIRT2514953	hsa-miR-149	CLIP-seq
MIRT2514955	hsa-miR-181a	CLIP-seq
MIRT2514956	hsa-miR-181b	CLIP-seq
MIRT2514957	hsa-miR-181c	CLIP-seq
MIRT2514958	hsa-miR-181d	CLIP-seq
MIRT2514959	hsa-miR-1827	CLIP-seq
MIRT2514960	hsa-miR-183	CLIP-seq
MIRT2514961	hsa-miR-1910	CLIP-seq
MIRT2514962	hsa-miR-194	CLIP-seq
MIRT2514963	hsa-miR-219-2-3p	CLIP-seq
MIRT2514964	hsa-miR-2467-5p	CLIP-seq
MIRT931310	hsa-miR-2681	CLIP-seq
MIRT2514965	hsa-miR-26a	CLIP-seq
MIRT2514966	hsa-miR-26b	CLIP-seq
MIRT931311	hsa-miR-298	CLIP-seq
MIRT2514967	hsa-miR-3064-5p	CLIP-seq
MIRT2386828	hsa-miR-31	CLIP-seq
MIRT2514968	hsa-miR-3119	CLIP-seq
MIRT2514969	hsa-miR-3121-3p	CLIP-seq
MIRT2514970	hsa-miR-3130-3p	CLIP-seq
MIRT931313	hsa-miR-3144-5p	CLIP-seq
MIRT931315	hsa-miR-3154	CLIP-seq
MIRT931316	hsa-miR-3163	CLIP-seq
MIRT2514971	hsa-miR-3171	CLIP-seq
MIRT2514972	hsa-miR-3173-3p	CLIP-seq
MIRT931317	hsa-miR-3179	CLIP-seq
MIRT931318	hsa-miR-3188	CLIP-seq
MIRT931319	hsa-miR-3191	CLIP-seq
MIRT2514973	hsa-miR-3200-5p	CLIP-seq
MIRT2514974	hsa-miR-326	CLIP-seq
MIRT2514975	hsa-miR-330-5p	CLIP-seq
MIRT2514976	hsa-miR-3607-3p	CLIP-seq
MIRT2514977	hsa-miR-3612	CLIP-seq
MIRT931322	hsa-miR-3651	CLIP-seq
MIRT2514980	hsa-miR-3670	CLIP-seq
MIRT2514981	hsa-miR-3671	CLIP-seq
MIRT2514982	hsa-miR-3686	CLIP-seq
MIRT1975611	hsa-miR-374a	CLIP-seq
MIRT1975612	hsa-miR-374b	CLIP-seq
MIRT2514983	hsa-miR-3908	CLIP-seq
MIRT2211120	hsa-miR-3925-5p	CLIP-seq
MIRT2514984	hsa-miR-3934	CLIP-seq
MIRT2514985	hsa-miR-3942-5p	CLIP-seq
MIRT2514986	hsa-miR-3975	CLIP-seq
MIRT2514987	hsa-miR-4251	CLIP-seq
MIRT2514988	hsa-miR-4262	CLIP-seq
MIRT931324	hsa-miR-4271	CLIP-seq
MIRT2211123	hsa-miR-4311	CLIP-seq
MIRT2514989	hsa-miR-4329	CLIP-seq
MIRT2514990	hsa-miR-4419a	CLIP-seq
MIRT2386831	hsa-miR-4436b-3p	CLIP-seq
MIRT2514991	hsa-miR-4446-5p	CLIP-seq
MIRT1975613	hsa-miR-4450	CLIP-seq
MIRT2514992	hsa-miR-4462	CLIP-seq
MIRT2514993	hsa-miR-4465	CLIP-seq
MIRT931325	hsa-miR-4483	CLIP-seq
MIRT2514994	hsa-miR-4494	CLIP-seq
MIRT931326	hsa-miR-4496	CLIP-seq
MIRT2514995	hsa-miR-4510	CLIP-seq
MIRT2514996	hsa-miR-4522	CLIP-seq
MIRT2514997	hsa-miR-4528	CLIP-seq
MIRT2514998	hsa-miR-455-3p	CLIP-seq
MIRT1975614	hsa-miR-4643	CLIP-seq
MIRT931327	hsa-miR-4652-5p	CLIP-seq
MIRT2514999	hsa-miR-4662a-5p	CLIP-seq
MIRT931328	hsa-miR-4666-5p	CLIP-seq
MIRT2515000	hsa-miR-4690-5p	CLIP-seq
MIRT2515001	hsa-miR-4693-3p	CLIP-seq
MIRT931332	hsa-miR-4701-3p	CLIP-seq
MIRT2515002	hsa-miR-4703-5p	CLIP-seq
MIRT2515003	hsa-miR-4709-3p	CLIP-seq
MIRT2515004	hsa-miR-4712-3p	CLIP-seq
MIRT1975616	hsa-miR-4717-3p	CLIP-seq
MIRT931334	hsa-miR-4725-3p	CLIP-seq
MIRT2515005	hsa-miR-4733-3p	CLIP-seq
MIRT2515006	hsa-miR-4739	CLIP-seq
MIRT2515007	hsa-miR-4742-5p	CLIP-seq
MIRT2515008	hsa-miR-4756-5p	CLIP-seq
MIRT1975618	hsa-miR-4760-3p	CLIP-seq
MIRT2386833	hsa-miR-4761-3p	CLIP-seq
MIRT2515009	hsa-miR-4766-3p	CLIP-seq
MIRT2515010	hsa-miR-4768-5p	CLIP-seq
MIRT2211129	hsa-miR-4773	CLIP-seq
MIRT2515011	hsa-miR-4775	CLIP-seq
MIRT2515012	hsa-miR-4794	CLIP-seq
MIRT2211131	hsa-miR-4802-3p	CLIP-seq
MIRT2515013	hsa-miR-485-5p	CLIP-seq
MIRT931337	hsa-miR-491-5p	CLIP-seq
MIRT1975619	hsa-miR-498	CLIP-seq
MIRT2515014	hsa-miR-499a-5p	CLIP-seq
MIRT2515015	hsa-miR-510	CLIP-seq
MIRT2515017	hsa-miR-512-5p	CLIP-seq
MIRT2515018	hsa-miR-522	CLIP-seq
MIRT931340	hsa-miR-548c-3p	CLIP-seq
MIRT2515022	hsa-miR-556-5p	CLIP-seq
MIRT2515023	hsa-miR-574-5p	CLIP-seq
MIRT2515024	hsa-miR-576-5p	CLIP-seq
MIRT931342	hsa-miR-589	CLIP-seq
MIRT2515025	hsa-miR-590-3p	CLIP-seq
MIRT2515026	hsa-miR-600	CLIP-seq
MIRT2386835	hsa-miR-633	CLIP-seq
MIRT1975620	hsa-miR-642b	CLIP-seq
MIRT2515027	hsa-miR-650	CLIP-seq
MIRT2515028	hsa-miR-653	CLIP-seq
MIRT2515029	hsa-miR-767-3p	CLIP-seq
MIRT2515030	hsa-miR-767-5p	CLIP-seq
MIRT2211137	hsa-miR-885-3p	CLIP-seq
MIRT2211138	hsa-miR-922	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002230	Process	Positive regulation of defense response to virus by host	IMP	19609254
GO:0002376	Process	Immune system process	IEA
GO:0002684	Process	Positive regulation of immune system process	IEA
GO:0002735	Process	Positive regulation of myeloid dendritic cell cytokine production	IEA
GO:0002735	Process	Positive regulation of myeloid dendritic cell cytokine production	ISS
GO:0002753	Process	Cytoplasmic pattern recognition receptor signaling pathway	IBA
GO:0002753	Process	Cytoplasmic pattern recognition receptor signaling pathway	IDA	16125763, 17392790, 29441066
GO:0002753	Process	Cytoplasmic pattern recognition receptor signaling pathway	IDA	19576794
GO:0002753	Process	Cytoplasmic pattern recognition receptor signaling pathway	TAS	21616437
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003724	Function	RNA helicase activity	IEA
GO:0003724	Function	RNA helicase activity	IMP	19211564
GO:0003725	Function	Double-stranded RNA binding	IBA
GO:0003725	Function	Double-stranded RNA binding	IDA	19576794
GO:0003725	Function	Double-stranded RNA binding	IEA
GO:0003725	Function	Double-stranded RNA binding	IMP	19211564
GO:0003725	Function	Double-stranded RNA binding	TAS	17079289
GO:0003727	Function	Single-stranded RNA binding	IBA
GO:0003727	Function	Single-stranded RNA binding	IEA
GO:0003727	Function	Single-stranded RNA binding	IMP	19211564
GO:0004386	Function	Helicase activity	IEA
GO:0005515	Function	Protein binding	IPI	16127453, 16177806, 16281057, 16585524, 17079289, 17190814, 17460044, 17709747, 18200010, 18636086, 18724357, 18818105, 19017631, 19164550, 19193793, 19380580, 19419966, 20007272, 20080758, 20127681, 20434986, 20818395, 21102435, 21233210, 21791617, 21813773, 21844353, 21903422, 221
GO:0005524	Function	ATP binding	IEA
GO:0005525	Function	GTP binding	IMP	21233210
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	15208624, 27807226
GO:0005737	Component	Cytoplasm	IDA	21102435
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005923	Component	Bicellular tight junction	IDA	19122199
GO:0005923	Component	Bicellular tight junction	IEA
GO:0008270	Function	Zinc ion binding	IBA
GO:0008270	Function	Zinc ion binding	IDA	18243112
GO:0009299	Process	MRNA transcription	IDA	9891032
GO:0009597	Process	Detection of virus	IDA	17079289
GO:0009615	Process	Response to virus	IEA
GO:0009615	Process	Response to virus	TAS	21616437
GO:0010467	Process	Gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	24409285
GO:0015629	Component	Actin cytoskeleton	IDA	19122199
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IMP	19211564
GO:0030334	Process	Regulation of cell migration	IDA	19122199
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	23950712, 26471729, 31006531
GO:0032587	Component	Ruffle membrane	IDA	19122199
GO:0032587	Component	Ruffle membrane	IEA
GO:0032725	Process	Positive regulation of granulocyte macrophage colony-stimulating factor production	IDA	24409285
GO:0032727	Process	Positive regulation of interferon-alpha production	IDA	19576794
GO:0032727	Process	Positive regulation of interferon-alpha production	IMP	19609254, 21957149
GO:0032728	Process	Positive regulation of interferon-beta production	IDA	17079289
GO:0032728	Process	Positive regulation of interferon-beta production	IEA
GO:0032728	Process	Positive regulation of interferon-beta production	IMP	19609254, 19631370, 21957149
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	24409285
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	21957149
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	24409285
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	21957149
GO:0034344	Process	Regulation of type III interferon production	TAS	21616437
GO:0038187	Function	Pattern recognition receptor activity	IDA	19576794, 25119032, 28469175, 35263596
GO:0039529	Process	RIG-I signaling pathway	IDA	28469175
GO:0039529	Process	RIG-I signaling pathway	IMP	19211564
GO:0042802	Function	Identical protein binding	IPI	17190814, 20581823, 21102435, 24590070, 34544279
GO:0042995	Component	Cell projection	IEA
GO:0043330	Process	Response to exogenous dsRNA	IEA
GO:0043330	Process	Response to exogenous dsRNA	IEA
GO:0043330	Process	Response to exogenous dsRNA	ISS
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	IMP	19609254, 19631370
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	17079289
GO:0046872	Function	Metal ion binding	IEA
GO:0051607	Process	Defense response to virus	IDA	21478870
GO:0051607	Process	Defense response to virus	IEA
GO:0060760	Process	Positive regulation of response to cytokine stimulus	IMP	21957149
GO:0070161	Component	Anchoring junction	IEA
GO:0071360	Process	Cellular response to exogenous dsRNA	IMP	21957149
GO:0140374	Process	Antiviral innate immune response	IBA
GO:0140374	Process	Antiviral innate immune response	IDA	9891032, 14703513, 17392790, 18984593, 27992402
GO:0140374	Process	Antiviral innate immune response	IDA	28469175
GO:1990904	Component	Ribonucleoprotein complex	IDA	31006531

Other IDs

• MIM: 609631
• HGNC: 19102
• e!Ensembl: ENSG00000107201

Protein

• UniProt ID: O95786
• Protein name: Antiviral innate immune response receptor RIG-I (ATP-dependent RNA helicase DDX58) (EC 3.6.4.13) (DEAD box protein 58) (RIG-I-like receptor 1) (RLR-1) (RNA sensor RIG-I) (Retinoic acid-inducible gene 1 protein) (RIG-1) (Retinoic acid-inducible gene I prot
• Protein function: Innate immune receptor that senses cytoplasmic viral nucleic acids and activates a downstream signaling cascade leading to the production of type I interferons and pro-inflammatory cytokines (PubMed:15208624, PubMed:15708988, PubMed:16125763, Pu
• PDB: 2LWD, 2LWE, 2QFB, 2QFD, 2RMJ, 2YKG, 3LRN, 3LRR, 3NCU, 3OG8, 3ZD6, 3ZD7, 4AY2, 4BPB, 4NQK, 4ON9, 4P4H, 5E3H, 5F98, 5F9F, 5F9H, 6GPG, 6KYV, 7BAH, 7BAI, 7JL1, 7JL3, 7MK1, 7TNX, 7TNY, 7TNZ, 7TO0, 7TO1, 7TO2, 8DVR, 8DVS, 8DVU, 8G7T, 8G7U, 8G7V, 8SCZ, 8SD0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16739	CARD_2	1 → 93	Caspase recruitment domain	Domain
  PF16739	CARD_2	99 → 190	Caspase recruitment domain	Domain
  PF00270	DEAD	244 → 420	DEAD/DEAH box helicase	Domain
  PF18119	RIG-I_C	457 → 602	RIG-I receptor C-terminal domain	Domain
  PF00271	Helicase_C	609 → 734	Helicase conserved C-terminal domain	Family
  PF11648	RIG-I_C-RD	806 → 923	C-terminal domain of RIG-I	Domain

• Tissue specificity: TISSUE SPECIFICITY: Present in vascular smooth cells (at protein level). {ECO:0000269|PubMed:15219805}.
• Sequence:

  MTTEQRRSLQAFQDYIRKTLDPTYILSYMAPWFREEEVQYIQAEKNNKGPMEAATLFLKF
  LLELQEEGWFRGFLDALDHAGYSGLYEAIESWDFKKIEKLEEYRLLLKRLQPEFKTRIIP
  TDIISDLSECLINQECEEILQICSTKGMMAGAEKLVECLLRSDKENWPKTLKLALEKERN
  KFSELWIVEKGIKDVETEDLEDKMETSDIQIFYQEDPECQNLSENSCPPSEVSDTNLYSP
  FKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKVVFFANQI
  PVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQILVNNLKKGTI
  PSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNT
  DEALDYICKLCASLDASVIATVKHNLEELEQVVYKPQKFFRKVESRISDKFKYIIAQLMR
  DTESLAKRICKDLENLSQIQNREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFL
  YTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESV
  SRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVDALKNWIEGNPKLSFLKPGI
  LTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVADEGIDIAQCNLVILYEYVGN
  VIKMIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKI
  LHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKE
  CFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATG
  VQTLYSKWKDFHFEKIPFDPAEMSK

• Sequence length: 925

Pathways

KEGG:

NF-kappa B signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Hepatitis C
Hepatitis B
Measles
Influenza A
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Coronavirus disease - COVID-19

Reactome:

ISG15 antiviral mechanism
DDX58/IFIH1-mediated induction of interferon-alpha/beta
Ub-specific processing proteases
Ovarian tumor domain proteases
OAS antiviral response
TRAF3-dependent IRF activation pathway
TRAF6 mediated IRF7 activation
TRAF6 mediated NF-kB activation
NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10
Negative regulators of DDX58/IFIH1 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
RIGI-related disorder	Likely pathogenic	rs2489331579	RCV003410480	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Singleton-Merten syndrome 2	Pathogenic; Likely pathogenic	rs786204847, rs786204848, rs1587586052	RCV000169760 RCV000169761 RCV000988170	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS C	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY SKIN DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS VULGARIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult type dermatomyositis	Dermatomyositis	BEFREE	20015976, 24604766, 28738907, 31142372		★☆☆☆☆ Found in Text Mining only
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	26993858		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	26525917		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	28468914		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	25315416		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	29567028	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	29567028		★☆☆☆☆ Found in Text Mining only
Aortic Valve Calcification of	Aortic valve disease	Pubtator	25620203	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	18505427, 21337319	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	26399222	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29504610		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	17485888	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	28738907	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	20877565, 21947008, 27512060, 28180316, 30047865, 32231389	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	21268286, 28180316, 29525183, 31433974		★☆☆☆☆ Found in Text Mining only
Blindness	Blindness	Pubtator	34935440	Associate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	37100811	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16080475, 30224377		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	39351539	Inhibit	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	16946700	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25100852, 40312343	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26992218	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	25315416	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	30137025	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31800094		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31207307		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	24992168, 27604339, 31170225		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28224203		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28385609, 29496994		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28057020, 28224203, 30004146		★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	29790851, 30924966		★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	32035159	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29392080		★☆☆☆☆ Found in Text Mining only
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	26535695		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	26535695		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	28377495		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	37540585	Associate	★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	LHGDN	17182220		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	20015976, 24604766, 28738907, 31142372		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	28738907, 28819164, 31142372, 32846838, 36854567	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36139069	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	38034011	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	19324880		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	34935440	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36068443	Associate	★☆☆☆☆ Found in Text Mining only
Eye Diseases	Eye disease	Pubtator	34935440	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	25620203		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	25620203, 33495304	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	33495304	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23390110		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23390110		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	28424327, 31628411		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	30574673	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	37100811	Stimulate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	25721089		★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	23060457, 30974086	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis C Chronic	Hepatitis c	Pubtator	28180316	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	24942949	Associate	★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	16946700	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	28819164	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	19706707		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	24604766		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	28377495		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	29970461		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	20167631		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	15297736, 21224412, 24412064	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	21224412, 24412064, 36076988	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	28656276, 32513696	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	21224412		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24918927, 26992218		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37100811	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	29321042	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	21268286, 24719229, 31681326		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	20167631, 24719229		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	35502341, 36261300	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23484008	Associate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	23955621, 25318809	Associate	★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	31142372		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16080475, 30224377		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31800094		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30545600		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30250402		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22960220, 26392348, 28468914, 30250402, 30836160, 31515294		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28385609, 29496994		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	30224377		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	18978796, 23370279, 26829212, 28560754, 29207132, 31515294		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	19620789, 35697379	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	26392348		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	26392348	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	24440286		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	34580642	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	36139069	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	23576520	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	23576520, 30659926	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	25721089, 30659926, 31464090		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10687848, 12014653, 16255778, 25721089, 26392348, 28709002, 29989043, 30224377, 31088527, 31519811, 31776268		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	26208481, 32824929	Associate	★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	26535695		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	28077651		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	25721089		★☆☆☆☆ Found in Text Mining only
Nodular Sclerosis Classical Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	27267403		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26336994, 30278439		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	16080475		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	36851534	Inhibit	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	16080475		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	21337319, 25407789	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31800094		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31800094	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30545600		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	22072781		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	24604766		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	26535695		★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	30633820		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	17928888	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	CTD_human_DG	23143594		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASDB_DG	23143594		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASCAT_DG	23143594, 25574825, 25903422		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	25658361, 26518362		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	20395558, 23384071, 31170225	Associate	★☆☆☆☆ Found in Text Mining only
Pustulosis of Palms and Soles	Palmoplantar Pustules	CTD_human_DG	23143594		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	37847581	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	18155685	Associate	★☆☆☆☆ Found in Text Mining only
Singleton Merten syndrome	Singleton Merten Syndrome	ORPHANET_DG	25620203		★☆☆☆☆ Found in Text Mining only
Singleton Merten syndrome	Singleton Merten Syndrome	BEFREE	29626090, 30047865, 30574673		★☆☆☆☆ Found in Text Mining only
Singleton-Merten dysplasia	Singleton Merten Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
SINGLETON-MERTEN SYNDROME 1	Singleton Merten Syndrome	GENOMICS_ENGLAND_DG	25620203		★☆☆☆☆ Found in Text Mining only
SINGLETON-MERTEN SYNDROME 2	Singleton Merten Syndrome	UNIPROT_DG	25620203		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SINGLETON-MERTEN SYNDROME 2	Singleton Merten Syndrome	BEFREE	29626090		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SINGLETON-MERTEN SYNDROME 2	Singleton Merten Syndrome	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Smith-Magenis syndrome	Smith-Magenis Syndrome	BEFREE	25620203		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23484008, 28061796	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23484008, 29348488		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	23673288		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30250402		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37443145	Associate	★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet syndrome	Pubtator	23955621	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Diseases	Testicular disease	Pubtator	37033952	Stimulate	★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	24440286		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	15297736	Associate	★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	30902577		★☆☆☆☆ Found in Text Mining only