Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23583
Gene name	Single-strand-selective monofunctional uracil-DNA glycosylase 1
Gene symbol	SMUG1
Synonyms (NCBI Gene)	FDGHMUDGUNG3
Chromosome	12
Chromosome location	12q13.13
Summary	This gene encodes a protein that participates in base excision repair by removing uracil from single- and double-stranded DNA. Many alternatively spliced transcript variants exist for this gene; the full-length nature is known for some but not all of the

298

Show/Hide all (298)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027837	hsa-miR-98-5p	Microarray	19088304
MIRT044695	hsa-miR-320a	CLASH	23622248
MIRT044695	hsa-miR-320a	CLASH	23622248
MIRT039050	hsa-miR-766-3p	CLASH	23622248
MIRT653299	hsa-miR-451b	HITS-CLIP	23824327
MIRT653297	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT653298	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT653296	hsa-miR-6828-5p	HITS-CLIP	23824327
MIRT653295	hsa-miR-671-5p	HITS-CLIP	23824327
MIRT653294	hsa-miR-3190-3p	HITS-CLIP	23824327
MIRT653293	hsa-miR-6079	HITS-CLIP	23824327
MIRT505569	hsa-miR-6507-3p	PAR-CLIP	23446348
MIRT505568	hsa-miR-3184-3p	PAR-CLIP	23446348
MIRT505567	hsa-miR-4436b-3p	PAR-CLIP	23446348
MIRT505566	hsa-miR-4632-5p	PAR-CLIP	23446348
MIRT505565	hsa-miR-6735-5p	PAR-CLIP	23446348
MIRT505564	hsa-miR-6879-5p	PAR-CLIP	23446348
MIRT505563	hsa-miR-7843-5p	PAR-CLIP	23446348
MIRT505562	hsa-miR-4761-3p	PAR-CLIP	23446348
MIRT505561	hsa-miR-142-5p	PAR-CLIP	23446348
MIRT505560	hsa-miR-5590-3p	PAR-CLIP	23446348
MIRT505559	hsa-miR-4639-3p	PAR-CLIP	23446348
MIRT505558	hsa-miR-1207-3p	PAR-CLIP	23446348
MIRT505557	hsa-miR-6787-3p	PAR-CLIP	23446348
MIRT505556	hsa-miR-150-5p	PAR-CLIP	23446348
MIRT505555	hsa-miR-532-3p	PAR-CLIP	23446348
MIRT505554	hsa-miR-2116-3p	PAR-CLIP	23446348
MIRT505553	hsa-miR-4427	PAR-CLIP	23446348
MIRT505552	hsa-miR-8078	PAR-CLIP	23446348
MIRT505551	hsa-miR-4713-5p	PAR-CLIP	23446348
MIRT653299	hsa-miR-451b	HITS-CLIP	23824327
MIRT653297	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT653298	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT653296	hsa-miR-6828-5p	HITS-CLIP	23824327
MIRT653295	hsa-miR-671-5p	HITS-CLIP	23824327
MIRT653294	hsa-miR-3190-3p	HITS-CLIP	23824327
MIRT653293	hsa-miR-6079	HITS-CLIP	23824327
MIRT505569	hsa-miR-6507-3p	PAR-CLIP	23446348
MIRT505568	hsa-miR-3184-3p	PAR-CLIP	23446348
MIRT505567	hsa-miR-4436b-3p	PAR-CLIP	23446348
MIRT505566	hsa-miR-4632-5p	PAR-CLIP	23446348
MIRT505565	hsa-miR-6735-5p	PAR-CLIP	23446348
MIRT505564	hsa-miR-6879-5p	PAR-CLIP	23446348
MIRT505563	hsa-miR-7843-5p	PAR-CLIP	23446348
MIRT505562	hsa-miR-4761-3p	PAR-CLIP	23446348
MIRT505561	hsa-miR-142-5p	PAR-CLIP	23446348
MIRT505560	hsa-miR-5590-3p	PAR-CLIP	23446348
MIRT505559	hsa-miR-4639-3p	PAR-CLIP	23446348
MIRT505558	hsa-miR-1207-3p	PAR-CLIP	23446348
MIRT505557	hsa-miR-6787-3p	PAR-CLIP	23446348
MIRT505556	hsa-miR-150-5p	PAR-CLIP	23446348
MIRT505555	hsa-miR-532-3p	PAR-CLIP	23446348
MIRT505554	hsa-miR-2116-3p	PAR-CLIP	23446348
MIRT505553	hsa-miR-4427	PAR-CLIP	23446348
MIRT505552	hsa-miR-8078	PAR-CLIP	23446348
MIRT505551	hsa-miR-4713-5p	PAR-CLIP	23446348
MIRT1374184	hsa-let-7a	CLIP-seq
MIRT1374185	hsa-let-7b	CLIP-seq
MIRT1374186	hsa-let-7c	CLIP-seq
MIRT1374187	hsa-let-7d	CLIP-seq
MIRT1374188	hsa-let-7e	CLIP-seq
MIRT1374189	hsa-let-7f	CLIP-seq
MIRT1374190	hsa-let-7g	CLIP-seq
MIRT1374191	hsa-let-7i	CLIP-seq
MIRT1374192	hsa-miR-1184	CLIP-seq
MIRT1374193	hsa-miR-1205	CLIP-seq
MIRT1374194	hsa-miR-1228	CLIP-seq
MIRT1374195	hsa-miR-1237	CLIP-seq
MIRT1374196	hsa-miR-130a	CLIP-seq
MIRT1374197	hsa-miR-130b	CLIP-seq
MIRT1374198	hsa-miR-141	CLIP-seq
MIRT1374199	hsa-miR-150	CLIP-seq
MIRT1374200	hsa-miR-186	CLIP-seq
MIRT1374201	hsa-miR-19a	CLIP-seq
MIRT1374202	hsa-miR-19b	CLIP-seq
MIRT1374203	hsa-miR-200a	CLIP-seq
MIRT1374204	hsa-miR-202	CLIP-seq
MIRT1374205	hsa-miR-2276	CLIP-seq
MIRT1374206	hsa-miR-2278	CLIP-seq
MIRT1374207	hsa-miR-301a	CLIP-seq
MIRT1374208	hsa-miR-301b	CLIP-seq
MIRT1374209	hsa-miR-3133	CLIP-seq
MIRT1374210	hsa-miR-3158-5p	CLIP-seq
MIRT1374211	hsa-miR-3666	CLIP-seq
MIRT1374212	hsa-miR-3925-3p	CLIP-seq
MIRT1374213	hsa-miR-3927	CLIP-seq
MIRT1374214	hsa-miR-3936	CLIP-seq
MIRT1374215	hsa-miR-4261	CLIP-seq
MIRT1374216	hsa-miR-4274	CLIP-seq
MIRT1374217	hsa-miR-4295	CLIP-seq
MIRT1374218	hsa-miR-4433	CLIP-seq
MIRT1374219	hsa-miR-4451	CLIP-seq
MIRT1374220	hsa-miR-4458	CLIP-seq
MIRT1374221	hsa-miR-4459	CLIP-seq
MIRT1374222	hsa-miR-4496	CLIP-seq
MIRT1374223	hsa-miR-4500	CLIP-seq
MIRT1374224	hsa-miR-4509	CLIP-seq
MIRT1374225	hsa-miR-454	CLIP-seq
MIRT1374226	hsa-miR-455-3p	CLIP-seq
MIRT1374227	hsa-miR-4670-5p	CLIP-seq
MIRT1374228	hsa-miR-4693-5p	CLIP-seq
MIRT1374229	hsa-miR-4732-5p	CLIP-seq
MIRT1374230	hsa-miR-4768-3p	CLIP-seq
MIRT1374231	hsa-miR-4772-3p	CLIP-seq
MIRT1374232	hsa-miR-4779	CLIP-seq
MIRT1374233	hsa-miR-519a	CLIP-seq
MIRT1374234	hsa-miR-519b-3p	CLIP-seq
MIRT1374235	hsa-miR-519c-3p	CLIP-seq
MIRT1374236	hsa-miR-544	CLIP-seq
MIRT1374237	hsa-miR-548ag	CLIP-seq
MIRT1374238	hsa-miR-548ai	CLIP-seq
MIRT1374239	hsa-miR-548m	CLIP-seq
MIRT1374240	hsa-miR-622	CLIP-seq
MIRT1374241	hsa-miR-665	CLIP-seq
MIRT1374242	hsa-miR-98	CLIP-seq
MIRT1374184	hsa-let-7a	CLIP-seq
MIRT1374185	hsa-let-7b	CLIP-seq
MIRT1374186	hsa-let-7c	CLIP-seq
MIRT1374187	hsa-let-7d	CLIP-seq
MIRT1374188	hsa-let-7e	CLIP-seq
MIRT1374189	hsa-let-7f	CLIP-seq
MIRT1374190	hsa-let-7g	CLIP-seq
MIRT1374191	hsa-let-7i	CLIP-seq
MIRT1374194	hsa-miR-1228	CLIP-seq
MIRT2111432	hsa-miR-1238	CLIP-seq
MIRT2111433	hsa-miR-1243	CLIP-seq
MIRT2111434	hsa-miR-1290	CLIP-seq
MIRT1374196	hsa-miR-130a	CLIP-seq
MIRT1374197	hsa-miR-130b	CLIP-seq
MIRT1374198	hsa-miR-141	CLIP-seq
MIRT1374199	hsa-miR-150	CLIP-seq
MIRT1374201	hsa-miR-19a	CLIP-seq
MIRT1374202	hsa-miR-19b	CLIP-seq
MIRT1374203	hsa-miR-200a	CLIP-seq
MIRT1374204	hsa-miR-202	CLIP-seq
MIRT1374205	hsa-miR-2276	CLIP-seq
MIRT1374206	hsa-miR-2278	CLIP-seq
MIRT1374207	hsa-miR-301a	CLIP-seq
MIRT1374208	hsa-miR-301b	CLIP-seq
MIRT2111435	hsa-miR-3167	CLIP-seq
MIRT2111436	hsa-miR-3613-3p	CLIP-seq
MIRT1374211	hsa-miR-3666	CLIP-seq
MIRT1374213	hsa-miR-3927	CLIP-seq
MIRT1374215	hsa-miR-4261	CLIP-seq
MIRT1374216	hsa-miR-4274	CLIP-seq
MIRT1374217	hsa-miR-4295	CLIP-seq
MIRT1374219	hsa-miR-4451	CLIP-seq
MIRT1374220	hsa-miR-4458	CLIP-seq
MIRT1374222	hsa-miR-4496	CLIP-seq
MIRT1374223	hsa-miR-4500	CLIP-seq
MIRT1374225	hsa-miR-454	CLIP-seq
MIRT2111437	hsa-miR-4705	CLIP-seq
MIRT1374229	hsa-miR-4732-5p	CLIP-seq
MIRT1374231	hsa-miR-4772-3p	CLIP-seq
MIRT2111438	hsa-miR-4775	CLIP-seq
MIRT1374233	hsa-miR-519a	CLIP-seq
MIRT1374234	hsa-miR-519b-3p	CLIP-seq
MIRT1374235	hsa-miR-519c-3p	CLIP-seq
MIRT1374240	hsa-miR-622	CLIP-seq
MIRT2111439	hsa-miR-876-5p	CLIP-seq
MIRT1374242	hsa-miR-98	CLIP-seq
MIRT1374184	hsa-let-7a	CLIP-seq
MIRT1374185	hsa-let-7b	CLIP-seq
MIRT1374186	hsa-let-7c	CLIP-seq
MIRT1374187	hsa-let-7d	CLIP-seq
MIRT1374188	hsa-let-7e	CLIP-seq
MIRT1374189	hsa-let-7f	CLIP-seq
MIRT1374190	hsa-let-7g	CLIP-seq
MIRT1374191	hsa-let-7i	CLIP-seq
MIRT1374194	hsa-miR-1228	CLIP-seq
MIRT2111433	hsa-miR-1243	CLIP-seq
MIRT2334511	hsa-miR-1283	CLIP-seq
MIRT1374196	hsa-miR-130a	CLIP-seq
MIRT1374197	hsa-miR-130b	CLIP-seq
MIRT1374198	hsa-miR-141	CLIP-seq
MIRT1374201	hsa-miR-19a	CLIP-seq
MIRT1374202	hsa-miR-19b	CLIP-seq
MIRT1374203	hsa-miR-200a	CLIP-seq
MIRT1374204	hsa-miR-202	CLIP-seq
MIRT1374205	hsa-miR-2276	CLIP-seq
MIRT1374206	hsa-miR-2278	CLIP-seq
MIRT1374207	hsa-miR-301a	CLIP-seq
MIRT1374208	hsa-miR-301b	CLIP-seq
MIRT1374210	hsa-miR-3158-5p	CLIP-seq
MIRT2334512	hsa-miR-3162-3p	CLIP-seq
MIRT2334513	hsa-miR-320b	CLIP-seq
MIRT2334514	hsa-miR-320c	CLIP-seq
MIRT2334515	hsa-miR-320d	CLIP-seq
MIRT2334516	hsa-miR-320e	CLIP-seq
MIRT2334517	hsa-miR-330-3p	CLIP-seq
MIRT2334518	hsa-miR-331-3p	CLIP-seq
MIRT2334519	hsa-miR-345	CLIP-seq
MIRT2111436	hsa-miR-3613-3p	CLIP-seq
MIRT2334520	hsa-miR-3616-3p	CLIP-seq
MIRT2334521	hsa-miR-3664-5p	CLIP-seq
MIRT1374211	hsa-miR-3666	CLIP-seq
MIRT2334522	hsa-miR-3691-3p	CLIP-seq
MIRT1374212	hsa-miR-3925-3p	CLIP-seq
MIRT1374213	hsa-miR-3927	CLIP-seq
MIRT2334523	hsa-miR-3938	CLIP-seq
MIRT2334524	hsa-miR-4256	CLIP-seq
MIRT1374215	hsa-miR-4261	CLIP-seq
MIRT1374216	hsa-miR-4274	CLIP-seq
MIRT1374217	hsa-miR-4295	CLIP-seq
MIRT2334525	hsa-miR-4325	CLIP-seq
MIRT2334526	hsa-miR-4429	CLIP-seq
MIRT1374218	hsa-miR-4433	CLIP-seq
MIRT1374219	hsa-miR-4451	CLIP-seq
MIRT1374220	hsa-miR-4458	CLIP-seq
MIRT1374221	hsa-miR-4459	CLIP-seq
MIRT2334527	hsa-miR-4470	CLIP-seq
MIRT1374222	hsa-miR-4496	CLIP-seq
MIRT1374223	hsa-miR-4500	CLIP-seq
MIRT1374225	hsa-miR-454	CLIP-seq
MIRT1374226	hsa-miR-455-3p	CLIP-seq
MIRT1374227	hsa-miR-4670-5p	CLIP-seq
MIRT2111437	hsa-miR-4705	CLIP-seq
MIRT1374229	hsa-miR-4732-5p	CLIP-seq
MIRT2334528	hsa-miR-4766-5p	CLIP-seq
MIRT1374230	hsa-miR-4768-3p	CLIP-seq
MIRT1374231	hsa-miR-4772-3p	CLIP-seq
MIRT1374232	hsa-miR-4779	CLIP-seq
MIRT2334529	hsa-miR-4796-3p	CLIP-seq
MIRT1374233	hsa-miR-519a	CLIP-seq
MIRT1374234	hsa-miR-519b-3p	CLIP-seq
MIRT1374235	hsa-miR-519c-3p	CLIP-seq
MIRT2334530	hsa-miR-520d-5p	CLIP-seq
MIRT2334531	hsa-miR-520g	CLIP-seq
MIRT2334532	hsa-miR-520h	CLIP-seq
MIRT2334533	hsa-miR-524-5p	CLIP-seq
MIRT2334534	hsa-miR-607	CLIP-seq
MIRT2334535	hsa-miR-615-5p	CLIP-seq
MIRT1374240	hsa-miR-622	CLIP-seq
MIRT1374241	hsa-miR-665	CLIP-seq
MIRT1374242	hsa-miR-98	CLIP-seq
MIRT1374192	hsa-miR-1184	CLIP-seq
MIRT2111432	hsa-miR-1238	CLIP-seq
MIRT2111433	hsa-miR-1243	CLIP-seq
MIRT2111434	hsa-miR-1290	CLIP-seq
MIRT2628558	hsa-miR-1294	CLIP-seq
MIRT2628559	hsa-miR-1323	CLIP-seq
MIRT2628560	hsa-miR-133a	CLIP-seq
MIRT2628561	hsa-miR-133b	CLIP-seq
MIRT2628562	hsa-miR-142-3p	CLIP-seq
MIRT2111435	hsa-miR-3167	CLIP-seq
MIRT2628563	hsa-miR-339-5p	CLIP-seq
MIRT2628564	hsa-miR-3653	CLIP-seq
MIRT2334521	hsa-miR-3664-5p	CLIP-seq
MIRT2628565	hsa-miR-3915	CLIP-seq
MIRT2628566	hsa-miR-3928	CLIP-seq
MIRT1374214	hsa-miR-3936	CLIP-seq
MIRT2628567	hsa-miR-4267	CLIP-seq
MIRT2628568	hsa-miR-4281	CLIP-seq
MIRT2628569	hsa-miR-431	CLIP-seq
MIRT2628570	hsa-miR-4316	CLIP-seq
MIRT2334525	hsa-miR-4325	CLIP-seq
MIRT1374218	hsa-miR-4433	CLIP-seq
MIRT2334527	hsa-miR-4470	CLIP-seq
MIRT1374224	hsa-miR-4509	CLIP-seq
MIRT2628571	hsa-miR-4677-3p	CLIP-seq
MIRT2111438	hsa-miR-4775	CLIP-seq
MIRT2628572	hsa-miR-511	CLIP-seq
MIRT2628573	hsa-miR-548a-3p	CLIP-seq
MIRT2628574	hsa-miR-548e	CLIP-seq
MIRT2628575	hsa-miR-548f	CLIP-seq
MIRT1374239	hsa-miR-548m	CLIP-seq
MIRT2628576	hsa-miR-548o	CLIP-seq
MIRT2628577	hsa-miR-640	CLIP-seq
MIRT2111439	hsa-miR-876-5p	CLIP-seq
MIRT1374192	hsa-miR-1184	CLIP-seq
MIRT2111432	hsa-miR-1238	CLIP-seq
MIRT2111433	hsa-miR-1243	CLIP-seq
MIRT2111434	hsa-miR-1290	CLIP-seq
MIRT2628558	hsa-miR-1294	CLIP-seq
MIRT2628559	hsa-miR-1323	CLIP-seq
MIRT2628560	hsa-miR-133a	CLIP-seq
MIRT2628561	hsa-miR-133b	CLIP-seq
MIRT2628562	hsa-miR-142-3p	CLIP-seq
MIRT2111435	hsa-miR-3167	CLIP-seq
MIRT2628563	hsa-miR-339-5p	CLIP-seq
MIRT2628564	hsa-miR-3653	CLIP-seq
MIRT2334521	hsa-miR-3664-5p	CLIP-seq
MIRT2628567	hsa-miR-4267	CLIP-seq
MIRT2628568	hsa-miR-4281	CLIP-seq
MIRT2628569	hsa-miR-431	CLIP-seq
MIRT2628570	hsa-miR-4316	CLIP-seq
MIRT2334525	hsa-miR-4325	CLIP-seq
MIRT1374218	hsa-miR-4433	CLIP-seq
MIRT2334527	hsa-miR-4470	CLIP-seq
MIRT2628571	hsa-miR-4677-3p	CLIP-seq
MIRT2111438	hsa-miR-4775	CLIP-seq
MIRT2628572	hsa-miR-511	CLIP-seq
MIRT2628573	hsa-miR-548a-3p	CLIP-seq
MIRT2628574	hsa-miR-548e	CLIP-seq
MIRT2628575	hsa-miR-548f	CLIP-seq
MIRT2628576	hsa-miR-548o	CLIP-seq
MIRT2628577	hsa-miR-640	CLIP-seq
MIRT2111439	hsa-miR-876-5p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
NFIC	Activation	14642566

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000703	Function	Oxidized pyrimidine nucleobase lesion DNA N-glycosylase activity	IBA
GO:0001650	Component	Fibrillar center	IDA
GO:0003677	Function	DNA binding	IEA
GO:0004844	Function	Uracil DNA N-glycosylase activity	IBA
GO:0004844	Function	Uracil DNA N-glycosylase activity	IDA	12718543
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 26871637, 29892012, 32296183, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA	12161446
GO:0005829	Component	Cytosol	IDA
GO:0006281	Process	DNA repair	IEA
GO:0006284	Process	Base-excision repair	IDA	12161446
GO:0006284	Process	Base-excision repair	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0017065	Function	Single-strand selective uracil DNA N-glycosylase activity	IDA	12161446, 12718543
GO:0017065	Function	Single-strand selective uracil DNA N-glycosylase activity	IEA
GO:0017065	Function	Single-strand selective uracil DNA N-glycosylase activity	TAS
GO:0019104	Function	DNA N-glycosylase activity	IDA	11526119
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0045008	Process	Depyrimidination	TAS

MIM	HGNC	e!Ensembl
607753	17148	ENSG00000123415

Q53HV7

Protein name

Single-strand selective monofunctional uracil DNA glycosylase (EC 3.2.2.-)

Protein function

Recognizes base lesions in the genome and initiates base excision DNA repair. Acts as a monofunctional DNA glycosylase specific for uracil (U) residues in DNA with a preference for single-stranded DNA substrates. The activity is greater toward m

Family and domains

Sequence

MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEY
AWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQE
HPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHCFVHNLCPLLFLAPSGRNLTPA
ELPAKQREQLLGICDAALCRQVQLLGVRLVVGVGRLAEQRARRALAGLMPEVQVEGLLHP
SPRNPQANKGWEAVAKERLNELGLLPLLLK

Sequence length

270

Interactions

View interactions

	KEGG		Reactome
	Base excision repair		Recognition and association of DNA glycosylase with site containing an affected pyrimidine Cleavage of the damaged pyrimidine Displacement of DNA glycosylase by APEX1

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (496)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
ACTH Syndrome, Ectopic	Ectopic ACTH secretion syndrome	BEFREE	30973841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	30537083, 31426749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	29061130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	31367253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	29293135, 30004938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	29356746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	27819858, 28423576, 28677069, 29125557, 29332233, 29480927, 29564671, 29656743, 30051884, 30733967, 30762824, 31162267, 31473660, 31652158, 31714278, 31792836 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	27511188, 28522744, 29561521, 31823231, 31833929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28650890, 28677069, 29261620, 29781772, 29922931, 30106864, 30324426, 30733967, 30776196, 30789397, 31021913, 31021916, 31300363, 31355526, 31380265, 31565568, 31652158 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	28098664, 28712692, 30629646, 31162267, 31402332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	30880747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	BEFREE	30080688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	29362133, 30308429, 30548894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	28775202, 31137014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	30589675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	29332161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Neoplasms	Adrenal neoplasia	BEFREE	29659392, 29760304, 29937176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	29334561, 29916915, 30413658, 30913014, 31107752, 31306205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal hyperplasia	Adrenal hyperplasia	BEFREE	29659387, 29762233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	28144908, 28382828, 28525457, 28701367, 29189488, 29195615, 29214417, 29288275, 29561528, 29675104, 29705879, 29728515, 29847317, 30300202, 30325829 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	28126883, 28596157, 28604477, 29166332, 29480328, 29653979, 29672465, 29783621, 29950864, 30032683, 30153146, 30198974, 30219963, 30247256, 30326627 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	28068826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	30664602, 31250167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	23202958, 23714858, 28095127, 29280283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	30308429, 30548894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	29742597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	28882421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	30003031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	28671117, 28941755, 29097597, 29396637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	27933416, 28120243, 29166751, 29717332, 29862846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anal carcinoma	Anal Cancer	BEFREE	28280225, 29096619, 30694369, 31506182, 31728763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	28591062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	28604478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic	Anemia	BEFREE	30888998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	30843001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angioedemas, Hereditary	Angioedema	BEFREE	29353998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angioendotheliomatosis	Angioendotheliomatosis	BEFREE	28166145, 28852831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	27832711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angiolymphoid hyperplasia	Angiolymphoid Hyperplasia	BEFREE	29561464, 31494704, 31587031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angiomyolipoma of kidney	Angiomyolipoma Of Kidney	BEFREE	28697195		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28274396, 28842811, 30868318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	29538024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28579485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28579485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	29850433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	29159573, 29356742, 29673292, 30012456, 31708339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	30308429, 30548894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	BEFREE	28719443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28109921, 28385306, 28450558, 28457625, 29177258, 29978245, 30411726, 30712152, 31004968, 31097993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28090641, 28583280, 29698933, 31015824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	27885810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	28362259	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28109921, 28385306, 28450558, 28457625, 29177258, 29978245, 30411726, 30712152, 31004968, 31097993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28229312, 30680588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrioventricular Block	Atrioventricular block	BEFREE	29061522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	BEFREE	28671117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	28671117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	29700125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	27688472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	BEFREE	31693620		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28240665, 29672465, 30806751, 31101745		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	28590301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Beckwith-Wiedemann Syndrome	Beckwith-Wiedemann Syndrome	BEFREE	29485435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behavioral variant of frontotemporal dementia	Behavioral Variant Of Frontotemporal Dementia	BEFREE	29614640, 29876274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	29532101, 29996673, 30065620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	28905105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	30506616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	27775939, 29302738, 30627815, 30666449, 31137599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	31634300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	31396797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachial Plexus Neuritis	Brachial plexus neuralgia	BEFREE	28759527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Abscess	Brain Abscess	BEFREE	29245306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	27987557, 28456080, 29275040, 29372376, 30248568, 30995685, 31584491, 31772624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	30516682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	30247208, 31088837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21427733, 24253812, 25111287, 25823388, 27587709, 27847287, 28045731, 28072617, 28166153, 28166159, 28263210, 28267530, 28468238, 28477166, 28488029 View all (63 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21427733, 25111287, 36156150	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	29145302, 29356747, 29401143, 30276438, 30788775, 31689284, 31693610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	28938677, 31267161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	28072618, 30143840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	30662544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	27565154, 27775939, 28256904, 28288040, 29302738, 30627815, 30666449, 31137599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	28005638, 29533345, 30197337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27539308, 27590191, 27768973, 28182730, 28253364, 28368886, 28632689, 28653494, 28678114, 28905105, 29116336, 29187498, 29561525, 29789994, 29916117 View all (20 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	30237211, 30312217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma testes	Testicular carcinoma	BEFREE	31568190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	28435455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27121932, 29260365, 29943313, 30101392, 30106857, 30207106, 30655750, 31126127, 31142357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	BEFREE	28179354, 29099613, 29762245, 31162259, 31642963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	29996673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	28263213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	26784940, 28498790, 29137072, 29145250, 30094546, 31358786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	27796543, 27799487, 28992382, 29186373, 29417417, 30575441, 30715503, 31385013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	31272325, 31823329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30680588		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	27819855, 28423698, 28427517, 28574816, 28632698, 29163839, 29683929, 29869485, 30069578, 30153151, 30154687, 30210633, 30545566, 30729273, 30739082 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical lymphadenopathy	Cervical lymphadenopathy	BEFREE	29293141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	27819855, 28427517, 28574816, 28632698, 29035993, 29163839, 29189444, 29369948, 30069578, 30153151, 30154687, 30210633, 30545566, 30662544, 30729273 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	28068826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28905105, 30762824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	BEFREE	29653972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	31524678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choledochal Cyst	Choledochal Cyst	BEFREE	30371587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	31524678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	29261626, 31396797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	BEFREE	29485439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	30411726, 30843013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29904040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28240672, 28590301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28547129, 31278814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic osteomyelitis	Osteomyelitis	BEFREE	29114183, 30032355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Q Fever	Q Fever	BEFREE	28546336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	31261240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30413657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	27811120, 28250335, 29490919, 29844865, 29863575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	29485448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17029639, 27454870, 28179354, 28224325, 28481810, 28487728, 28770274, 28895416, 28902737, 29198007, 29459018, 29736846, 30075550, 30515068, 30893213, 31267161, 31330410, 31642963 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17029639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	27896807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete hydatidiform mole	Complete Hydatidiform Mole	BEFREE	28759528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital absence of lung	Congenital lung agenesis	BEFREE	27645693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	29245306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	30678829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	28912249, 29848727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	28807509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	27473218, 30421379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27824726, 28068944, 28134692, 28288043, 28331985, 29432340, 29464355, 29485439, 30371589, 30377936, 30488140, 30762823, 31140234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	26951555, 28160263, 28490354, 31194212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	26951555, 28160263, 28490354, 30208407		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	26951555, 28160263, 28490354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corticobasal degeneration	Corticobasal Degeneration	BEFREE	28912150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Creutzfeldt-Jakob Disease, Sporadic	Creutzfeldt-Jakob disease	BEFREE	30223705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cri-du-Chat Syndrome	5p partial monosomy syndrome	BEFREE	31836684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	28902728, 29043862, 29097934, 29455313, 30389814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	31137014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	27775937, 28885538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	29653972		★★★★★ ★☆☆☆☆ Found in Text Mining only
DEAFNESS, AUTOSOMAL RECESSIVE 4, WITH ENLARGED VESTIBULAR AQUEDUCT	Deafness	BEFREE	28195913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29893752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	27334943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	27107028, 28507319, 28551486, 29232244, 29512075, 29538658, 29713763, 29779045, 30010119, 30094462, 30101060, 30414086, 30927601, 31107281, 31322568, 31446507, 31633646 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29955973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	30664602, 31250167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29232246, 29927635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29177258, 29232246, 29927635, 30373519, 31769591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30514933, 30889184, 31002171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	27844413, 27846003, 27849386, 29531251, 29550843, 29618578, 30015659, 30160089, 30273012, 30422898, 30511173, 30864903, 31117054, 31237886, 31273354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Intrinsic Pontine Glioma	Diffuse Intrinsic Pontine Glioma	BEFREE	28360212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	28099514, 28144908, 28382828, 28416502, 28525457, 28629257, 28701367, 28796066, 29189488, 29195615, 29214417, 29288275, 29390562, 29561528, 29675104 View all (16 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	30652258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystonia Disorders	Dystonia	BEFREE	31256288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Early infantile epileptic encephalopathy with suppression bursts	Epileptic Encephalopathy	BEFREE	28195914, 30630738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	30679215, 30863933, 31611047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enchondroma	Enchondroma	BEFREE	31396797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocarditis	Endocarditis	BEFREE	28474192, 28546336, 28585026, 29351615, 29630121, 30949690, 31485962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	28240667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28167243, 28828510, 28830238, 29185901, 30136163, 30235772, 30711937, 31165242, 31568194, 31576685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	BEFREE	29698933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enthesitis	Enthesitis	BEFREE	28265227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsies, Partial	Epilepsy	BEFREE	28595975, 28806243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28919879, 29933054, 30370531, 31034972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	29671038, 30013926, 31001198, 31338549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	27121932, 29260365, 29943313, 31126127, 31142357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioid hemangioendothelioma	Epithelioid Hemangioendothelioma	BEFREE	30516676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	28264726, 29263700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erdheim-Chester Disease	Erdheim-Chester Disease	BEFREE	29485431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythema Nodosum	Erythema nodosum	BEFREE	27775948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	26834115, 27001344, 27569732, 27613542, 28123302, 28487611, 29023336, 29130979, 29135612, 29281031, 29504964, 29672463, 29679113, 29917073, 29953743 View all (17 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	27001344, 27613542, 28123302, 28487611, 29023336, 29130979, 29672463, 29917073, 29953743, 30055238, 30116837, 30300200, 30392070, 30394932, 30418211 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	23504502	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Tremor	Tremor	BEFREE	30085092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	28928879, 29620679, 30680447, 31016339, 31135716, 31524682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	30022384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	30879055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Facial paralysis	Facial paralysis	BEFREE	31693602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	31823231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	31077075, 31769591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Favre-Racouchot Syndrome	Favre-Racouchot Syndrome	BEFREE	28456818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	28905201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30414009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrous dysplasia of bone with intramuscular myxoma	Fibrous Dysplasia Of Bone With Intramuscular Myxoma	BEFREE	29863575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	31000525		★★★★★ ★☆☆☆☆ Found in Text Mining only
FOCAL CORTICAL DYSPLASIA OF TAYLOR	Focal cortical dysplasia	BEFREE	29594410, 29704039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	28483398, 28671127, 30569187, 31028167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	30829860, 31250573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	27909884, 29485442, 31377821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	27619357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastro-enteropancreatic neuroendocrine tumor	Digestive system neuroendocrine neoplasm	BEFREE	28529632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	28970330, 29166334, 29315500, 31646354, 31781931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	31366569, 31568190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	28265227, 28508663, 28658131, 28856429, 28865740, 28911987, 29126277, 29671039, 29729443, 29799393, 29903537, 30015661, 30066157, 30322478, 30976984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29207673, 29948641, 30214639, 30814660, 30989436, 31693607, 31841816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29207673, 29948641, 30214639, 30814660, 30989436, 31693607, 31841816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27789719, 27846000, 28341716, 28567708, 30519867, 31524681, 31803608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	28806242, 29293138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	31693622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis	Granulomatosis	BEFREE	28134697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	28650889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gynecomastia	Gynecomastia	BEFREE	29166332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	30985440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma	Hamartoma	BEFREE	28591477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	28027517, 28357549, 28697190, 28745907, 28771540, 28940101, 29160180, 29234851, 29273260, 29324917, 29573279, 29774104, 30363632, 30394934, 30456825 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	28263213, 29243072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30421379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Neoplasm	Cardiac Neoplasms	BEFREE	30036249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	30985433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	28632698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	30843002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemimegalencephaly	Hemimegalencephaly	BEFREE	28195914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia B	Hemophilia	BEFREE	31021910, 31274624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	30325817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	29485435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Leiomyomatosis and Renal Cell Cancer	Hereditary Leiomyomatosis and Renal Cancer	BEFREE	30762823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hibernoma	Hibernoma	BEFREE	28465871, 28902737, 30358644		★★★★★ ★☆☆☆☆ Found in Text Mining only
High Grade Lymphoma (neoplasm)	High Grade Lymphoma	BEFREE	28525457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytoma, Benign Fibrous	Benign fibrous histiocytoma	BEFREE	28632691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	BEFREE	27645693, 28748503, 30829872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	28126883, 28596157, 28604477, 28646013, 29166332, 29480328, 29485432, 29653979, 29672465, 29783621, 29950864, 30032683, 30153146, 30198974, 30219963 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Horseshoe Kidney	Horseshoe Kidney	BEFREE	27879491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	28418951, 29717332, 30325816, 31043171, 31256288, 31344728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	31135518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	31274562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30784923, 31304560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type III	Hyperlipoproteinemia	BEFREE	28336558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperoxaluria	Hyperoxaluria	BEFREE	30516684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	26715598, 28992382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	29176885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoalbuminemia	Hypoalbuminemia	BEFREE	31201673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothalamic hamartomas	Hypothalamic Hamartomas	BEFREE	28591477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	27774839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	28567495, 30065620, 30196378, 30908341, 30926647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	28831580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28449678, 29335764, 29974372, 30646908, 31286201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	27879372, 28280223, 28912150, 29261640, 30982329, 31286349, 31428041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	29686661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile myofibromatosis	myofibromatosis	BEFREE	31135521, 31274622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30081226, 30587768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Myofibroblastic Tumor	Inflammatory Myofibroblastic Tumor	BEFREE	28639954, 30036248, 30153139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	30941318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	26329496, 26784940, 28432480, 28498790, 28767583, 29135722, 29137072, 30061271, 30094546, 31358786, 31365497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28713979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile polyposis syndrome	Polyposis Syndrome	BEFREE	29707402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	28721937, 29137032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	28785537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	30411726, 30843013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	30234688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kleine-Levin Syndrome	Kleine-Levin Syndrome	BEFREE	28221196		★★★★★ ★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	28382795, 29492644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	28852941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left ventricular noncompaction cardiomyopathy	Cardiomyopathy	BEFREE	28379356		★★★★★ ★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	30018513, 30985441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma of uterus	Leiomyosarcoma Of Uterus	BEFREE	29492644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	28550639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	27688479, 29261640, 29876274, 30003031, 30075285, 30905401, 31138141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leydig Cell Tumor	Leydig Cell Tumor	BEFREE	29166332		★★★★★ ★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	28382795, 29492644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	30325831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	BEFREE	28465871		★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	28902737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	29926115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27775940, 27775949, 27789714, 27941378, 27942837, 28114226, 28429188, 28474165, 28901442, 29074969, 29124280, 29435123, 29561464, 29634658, 29901488 View all (15 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	30414009, 31261240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	28264009, 28338471, 30659557, 30719695, 31800510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	28082432, 28984815, 30290608, 30746239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	28831580, 30290608, 30348701, 31781994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	29679299, 29968182, 29983260, 30006600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28716225, 28806242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	29390326, 30150039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	28590296, 31162258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	28004400, 28259031, 28315904, 28411336, 28570287, 28632694, 28723740, 28798034, 29195613, 29195615, 29215415, 29360605, 29362839, 29561522, 29688953 View all (23 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	28382828, 28604477, 30913868, 31165310, 31348079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	29577608, 29950864, 30769193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	28647936, 29189443, 29270848, 29383519, 29480328, 29550841, 29577608, 29950864, 30358625, 30481598, 30769193, 31363153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	29577608, 29950864, 30358625, 30769193, 31363153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphomatoid Papulosis	Lymphomatoid Papulosis	BEFREE	31246687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	29076909, 29485445, 29538028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	28716225, 30186413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	30672757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	30052597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant granular cell tumor	Granular Cell Tumor	BEFREE	29847320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	28027517, 28357549, 28697190, 28745907, 28771540, 28940101, 29160180, 29234851, 29273260, 29324917, 29573279, 29774104, 30363632, 30394934, 30456825 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	30688737, 30929200, 31024918, 31371411, 31769415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	30371590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Mesothelioma of Peritoneum	Peritoneal mesothelioma	BEFREE	28244976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21427733, 24253812, 25111287, 25823388, 27541026, 27587709, 27847287, 28045731, 28072617, 28166153, 28166159, 28263210, 28267530, 28468238, 28477166 View all (62 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28167243, 28830238, 29185901, 30136163, 30235772, 30711937, 31165242, 31568194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	27001344, 27613542, 28123302, 28487611, 29023336, 29130979, 29218619, 29502309, 29663014, 29672463, 29721766, 29745630, 29917073, 29953743, 30055238 View all (18 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	30120698, 30762817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	28005638, 30197337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	27875761, 30562190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27539308, 27590191, 27768973, 28182730, 28253364, 28368886, 28632689, 28653494, 28678114, 28877268, 28905105, 29116336, 29117314, 29187498, 29561525 View all (23 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	29488161, 31606761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	28938677, 31267161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	28288042, 28604368, 29488161, 29960060, 30889002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30101392, 30106857, 30207106, 30655750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28180987, 28774338, 29061130, 29189377, 29782393, 30629646, 30921238, 30940428, 31365502, 31570958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of penis	Penile cancer	BEFREE	29536497, 30143840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28349676, 29125557, 29301928, 29681049, 30125515, 30445280, 30843003, 31236756, 31652158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29137440, 31848322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	30456190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	29025986, 29909471, 30160089, 30257714, 30422898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	27775939, 29302738, 30627815, 30666449, 31137599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21427733, 26407135, 27556798, 27631108, 27747383, 27775945, 27838763, 27849386, 27921286, 27922861, 27980049, 28028557, 28103230, 28134697, 28168798 View all (135 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	28068826, 28589254, 30023349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Testicular Germ Cell Tumor	Malignant testicular germ cell tumor	BEFREE	30456190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27819855, 28427517, 28574816, 28632698, 29163839, 30069578, 30153151, 30154687, 30210633, 30545566, 30729273, 30739082, 30769369, 30927941, 30998728 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	27811120, 28250335, 29844865, 29863575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	31201673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28488029, 28711994, 28893600, 29731479, 30112113, 30645633, 30728757, 31197455, 31729540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	30688737, 30929200, 31024918, 31286200, 31371411, 31733125, 31769415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	27941375, 30734341, 31807935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mediastinal lymphadenopathy	Mediastinal lymphadenopathy	BEFREE	30829862, 30932977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	28646462, 29025983, 30206772, 30562193, 30684230		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27775937, 28154879, 28389693, 28481788, 28697198, 28831583, 28872554, 29085965, 29742609, 29876618, 30112704, 30358644, 30665926, 31335691, 31363965, 31437839, 31481581, 31584495 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	30052597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29955973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	30370531, 31107281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	29405630, 29538029, 30032450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	29300270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30413661, 31306191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	28831583, 29478079, 29872898, 30413661, 30460579, 30478475, 30653029, 31335691, 31346755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	31652162		★★★★★ ★☆☆☆☆ Found in Text Mining only
MICROPHTHALMIA, SYNDROMIC 7	Syndromic microphthalmia	BEFREE	29926115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	28152536, 28280223, 28372331, 28664464, 28671117, 28922157, 29415470, 29439345, 29502311, 29538658, 29546632, 29762090, 30010119, 30101060, 30389825 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Milroy Disease	Milroy Disease	BEFREE	27792043		★★★★★ ★☆☆☆☆ Found in Text Mining only
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	30353210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	30008837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucinous carcinoma of breast	Mucinous Carcinoma Of Breast	BEFREE	30234689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	28004400, 28270020, 28830222, 28902730, 29517697, 30299563, 30702589, 30734341, 31260155, 31754896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia	Multiple Endocrine Neoplasia	BEFREE	28481789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	28323985, 29446832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	27573638, 27922862, 28042328, 28195903, 28368259, 28368891, 28822997, 29097930, 29226428, 29270787, 29633046, 29671193, 30015660, 30054697, 30194770 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	29764500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28183991, 28740146, 29792210, 31835854		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	31194212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	27638745, 28263213, 28418949, 28852983, 30128917, 30409737, 31835854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myofibromatosis	Myofibromatosis	BEFREE	31135521, 31274622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	29805526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	30664602, 31274562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myxoma	Myxoma	BEFREE	29926115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	BEFREE	29771387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	27980228, 28008776, 28091565, 28267540, 28445287, 28632691, 28871162, 28874126, 28938677, 29137018, 29187888, 29401153, 29502310, 29520429, 29762247, 30671740, 31267161, 31305420 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24253812, 24972688, 25425972, 26434685, 26834115, 27121713, 27444682, 27454870, 27541026, 27613542, 27645694, 27679399, 27704193, 27768973, 27792043 View all (244 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30298594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28072621, 29110068, 29667143, 30850970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	27334943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28240664, 28750498, 29713763, 29721650, 30101060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	27516446, 27906872, 28209907, 28323985, 28435454, 28435455, 28735662, 28759524, 28803235, 29118267, 29293142, 30640182, 30829861, 31306189, 31343606, 31350186 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	28589254, 30023349, 30106798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	28589254, 30106798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	28589254, 28771999, 30023349, 30106798, 30192842, 31395668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuronal heterotopia	Neuronal Heterotopia	BEFREE	28045733, 28806243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	28916879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30373519, 30991275, 31077075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26434685, 27180186, 27590191, 27600280, 27765858, 27922540, 28057034, 28253364, 28266166, 28273734, 28336778, 28405726, 28406970, 28419645, 28450567 View all (57 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nongerminomatous Germ Cell Tumor	Nongerminomatous Tumor	BEFREE	30413968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	28870933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	30506616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28509766, 30411728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	31337657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Opitz GBBB Syndrome, X-Linked	Opitz GBBB Syndrome, X-Linked	BEFREE	30630738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	28288042, 28604368, 29488161, 29960060, 30889002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	28654381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteochondrodysplasias	Osteochondrodysplasia	BEFREE	30680447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	29114175, 29114183, 29652746, 30903403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30188874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30188874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	27645694, 28405727, 28611244, 30497448, 30859285, 30953476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Otitis Externa	Otitis Externa	BEFREE	30549258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian adenocarcinoma	Ovarian adenocarcinoma	BEFREE	30349818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	31796665		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30101392, 30106857, 30207106, 30655750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Thecoma	Ovarian Thecoma	BEFREE	27987341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oxalosis	Hyperoxaluria	BEFREE	30516684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28180987, 28774338, 28806261, 28816978, 29061130, 29189377, 29782393, 30300198, 30629646, 30921238, 30940428, 31365502, 31404025, 31570958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Cyst	Pancreatic Cyst	BEFREE	31606313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	29728085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28842811, 29119533, 30868318, 31169124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31917448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	27818005, 28098664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Panniculitis	Panniculitis	BEFREE	27775948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28588229, 28639955, 29130586, 30394932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	27824319, 28806264, 29334561, 30413658, 30913014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraneoplastic Syndromes	Paraneoplastic Syndromes	BEFREE	27980049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Gland Adenocarcinoma	Parathyroid Gland Adenocarcinoma	BEFREE	28394837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	27879372, 27893588, 27922865, 28378615, 28912150, 29476004, 29779045, 29876274, 30514656, 30741687, 30930059, 31024233, 31050657, 31136763, 31256288, 31440389, 31768599, 31768600 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	28378615, 28912150, 29261640, 31050657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal hypertension	Paroxysmal Hypertension	BEFREE	28134695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peliosis Hepatis	Peliosis Hepatis	BEFREE	29659400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	29863573, 29884293, 31274563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	BEFREE	28806242, 29847320, 29884293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pericarditis, Constrictive	Pericarditis	BEFREE	30371590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nerve Sheath Neoplasm	Peripheral Nerve Sheath Neoplasm	BEFREE	31395668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	30371574, 30889000, 31737117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periventricular Nodular Heterotopia	Periventricular Nodular Heterotopia	BEFREE	31006947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	29334561, 29916915, 30413658, 30913014, 31107752, 31306205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	28483398, 30569187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	31519379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Plexiform Neurofibroma	Plexiform neurofibroma	BEFREE	28771999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis	Polyarthritis	BEFREE	31063606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	29653972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	BEFREE	30843002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	28604480, 28831580, 31693622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Vein Thrombosis	Portal Vein Thrombosis	BEFREE	28922192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	31073848, 31152209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Posterior cortical atrophy syndrome	Posterior cortical atrophy	BEFREE	27688479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Posterior reversible encephalopathy syndrome	Leukoencephalopathy	BEFREE	29356747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	31021910, 31274624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	28733763, 29293135, 30004938, 30688741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	27107028, 28507319, 28551486, 29512075, 29538658, 29713763, 29779045, 30010119, 30094462, 30101060, 30414086, 30927601, 31107281, 31322568, 31446507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	28514747, 29682187, 30214639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Cutaneous Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	31246687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Progressive Aphasia (disorder)	Aphasia	BEFREE	29744573, 30108500, 31419589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	28378615, 29536636, 29779045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28349676, 29125557, 29301928, 29681049, 30125515, 30445280, 30843003, 31236756, 31652158		★★★★★ ★☆☆☆☆ Found in Text Mining only
prostatitis	Prostatitis	BEFREE	27824318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	31385013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	30506616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30167994, 30646908, 31761645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	27271749, 28042958, 28060889, 29035999, 29046927, 29159523, 29378659, 30556862, 30718566, 30877175, 30880747, 30899056, 31842163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27824726, 28068944, 28134692, 28288043, 28331985, 29432340, 29464355, 29485439, 30120698, 30371589, 30377936, 30488140, 30762817, 30762823, 31140234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	30222681, 30762827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	27906709, 28237630, 31053684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	28650886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	30179913, 30187233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28583280, 28992382, 31015824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sacroiliitis	Sacroiliitis	BEFREE	29564671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	27604109, 28240658, 28681340, 28853043, 29538030, 29538031, 29681578, 29686996, 29721764, 30023349, 30658987, 31162254, 31195715, 31197630, 31274562 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	27990685, 28178131, 29803387, 30065620, 30196378, 30908341, 30926647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	27760700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	27888325, 29959212, 30064385, 30094460, 30850494, 31041456, 31107745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Semantic Dementia	Semantic Dementia	BEFREE	27916672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	28604478, 30413968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sinonasal undifferentiated carcinoma	Sinonasal undifferentiated carcinoma	BEFREE	27481043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sinus histiocytosis	Sinus Histiocytosis	BEFREE	28525449, 29215410, 31584488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sinus Thrombosis, Intracranial	Sinus Thrombosis, Intracranial	BEFREE	30516682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skeletal dysplasia	Skeletal Dysplasia	BEFREE	30680447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	30109356, 30624274, 31652157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	29916918, 30932977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	28195911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	26988938, 28405726, 29256260, 29443753, 30109543, 30900157, 31136534, 31271268, 31464894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	28550639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spermatic Cord Torsion	Spermatic Cord Torsion	BEFREE	30178446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	31634300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Cord Neoplasms	Spinal Cord Neoplasms	BEFREE	31107760, 31135522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	27503193, 27671150, 28534183, 29166335, 29656756, 30371593, 30675738, 30691667, 31010622, 31473660, 31689276, 31693608, 31705729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23504502, 28122340, 28368888, 28404900, 28872547, 29188300, 29434881, 29869060, 30222678, 30257714, 30615636, 30622778, 30675704, 30949816, 31218571 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	31005184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	28099264, 28195905, 28335778, 28939071, 31720757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	31095044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28004135, 28027517, 28055245, 28540535, 28764952, 28812148, 28864630, 28922190, 29164301, 29377508, 29526413, 29567343, 29931433, 30083516, 30157883 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	29383178, 31606831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	29039110, 30179912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stage IV Skin Melanoma	Skin Melanoma	BEFREE	28831583, 30460579, 31335691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29279943, 31077075, 31769591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	28567495, 30065620, 30196378, 30908341, 30926647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29137440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22894650, 23504502	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stunned Myocardium	Stunned Myocardium	BEFREE	31359109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	27796945, 30296175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subcutaneous panniculitis-like T-cell lymphoma	Subcutaneous Panniculitis-Like T-Cell Lymphoma	BEFREE	30431571, 31833924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Superior Vena Cava Syndrome	Superior Vena Cava Syndrome	BEFREE	29215407		★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	30589671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	31063606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis, Acne, Pustulosis, Hyperostosis, and Osteitis Syndrome	Synovitis, Acne, Pustulosis, Hyperostosis, and Osteitis (SAPHO) Syndrome	BEFREE	29788984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	30557130		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	27974685, 30624268, 30882662, 31795794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	28180963, 28856429, 29299706, 29465347, 29799393, 29889690, 30824642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	31583820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymic Carcinoma	Thymic Carcinoma	BEFREE	29263700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	29263700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroglossal Cyst	Thyroglossal Cyst	BEFREE	30371593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	29025986, 29909471, 30160089, 30257714, 30422898, 30859432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	31024448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	28949122, 29025986, 29909471, 30160089, 30257714, 30422898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	28793848, 30740757, 31135518, 31466411, 31632868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyrotoxicosis	Thyrotoxicosis	BEFREE	28746199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29791503, 30321870, 31452065, 31757841, 31781983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29564671, 31650217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	28716225, 30186413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	28368895, 28481800, 31137599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Carcinosarcoma	Endometrial Cancer	BEFREE	28541634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	BEFREE	29189444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	28287942, 28905201, 29390568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	30658987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vaginal Neoplasms	Vaginal Neoplasms	BEFREE	30688732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	31385013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	28237004, 28856429, 29126277, 30015661, 30066157, 30296989, 31531005, 31820718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis of large artery	Vasculitis	BEFREE	28109928, 28765420, 28967430, 29729443, 29903537, 29927635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular Fibrillation	BEFREE	28954832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vipoma	VIPoma	BEFREE	30391116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	30985433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	29742593, 31101745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Wernicke Encephalopathy	Wernicke Encephalopathy	BEFREE	31058688		★★★★★ ★☆☆☆☆ Found in Text Mining only
X-linked infantile spasms	Spasms X-Linked	BEFREE	28195914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	28562539		★★★★★ ★☆☆☆☆ Found in Text Mining only

SMUG1 (single-strand-selective monofunctional uracil-DNA glycosylase 1)